Clone Sequence Records
BS17710.complete Sequence
302 bp assembled on 2010-02-09
GenBank Submission: KX805188
> BS17710.complete
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTTAAAAGCTTTCTAGACC
AT
BS17710.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:07:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ctp-RE | 270 | CG6998-PE | 1..270 | 17..286 | 1350 | 100 | Plus |
ctp-RC | 270 | CG6998-PC | 1..270 | 17..286 | 1350 | 100 | Plus |
ctp-RA | 270 | CG6998-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:07:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ctp-RE | 4061 | CG6998-RE | 216..486 | 17..287 | 1355 | 100 | Plus |
ctp-RC | 4416 | CG6998-RC | 571..841 | 17..287 | 1355 | 100 | Plus |
ctp-RA | 1483 | CG6998-RA | 216..486 | 17..287 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:07:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 4698295..4698459 | 123..287 | 825 | 100 | Plus |
2L | 23513712 | 2L | 1344616..1344886 | 17..287 | 740 | 84.9 | Plus |
X | 23542271 | X | 4691737..4691845 | 17..125 | 545 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 03:07:38 has no hits.
BS17710.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:26:59 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 1..270 | 17..286 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:15:20 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RB | 329..596 | 17..284 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:36:01 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 216..483 | 17..284 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:26:59 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RB | 321..599 | 9..287 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:43:26 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 216..483 | 17..284 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:43:26 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4691737..4691844 | 17..124 | 100 | -> | Plus |
X | 4698297..4698456 | 125..284 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:36:01 Download gff for
BS17710.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 4585770..4585877 | 17..124 | 100 | -> | Plus |
arm_X | 4592330..4592489 | 125..284 | 100 | | Plus |
BS17710.3prime Sequence
300 bp (300 high quality bases) assembled on 2007-05-29
> BS17710.3prime
ATGGTCTAGAAAGCTTTTAACCGCTCTTAAACAGTAAAATAGCCACCTGG
CCCAAATAGAAGTAAATAAAGTGGCGCGTCTCGTGTGTGACATACGATCC
AAAGTTGCGACCGACAATGCAATGCCATGTGGGATTGTATTTTTTGTCGA
ACTCCTTCTTGATGTAGGCCGCAATGTCCTTTTCAATGTTGTACTTCTCG
AGGGCCTGTGTCGCACAATCGACGGCATCCTGCTGCATCTCCTCGCTCAT
GTCGGCATTTTTAATCACGGCCTTGCGATCAGACATGTCGACTGATAACT
BS17710.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6998-PB | 270 | ctp-RB | 1..270 | 286..17 | 1350 | 100 | Minus |
CG6998-PD | 270 | ctp-RD | 1..270 | 286..17 | 1350 | 100 | Minus |
CG6998-PA | 270 | ctp-RA | 1..270 | 286..17 | 1350 | 100 | Minus |
CG6998-PC | 270 | ctp-RC | 1..270 | 286..17 | 1350 | 100 | Minus |
CG5450-PA | 270 | Cdlc2-RA | 79..218 | 208..69 | 250 | 87.1 | Minus |
CG5450-PB | 270 | Cdlc2-RB | 79..218 | 208..69 | 250 | 87.1 | Minus |
CG5450-PA | 270 | Cdlc2-RA | 1..59 | 286..228 | 145 | 89.8 | Minus |
CG5450-PB | 270 | Cdlc2-RB | 1..59 | 286..228 | 145 | 89.8 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:31:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ctp-RE | 4061 | CG6998-RE | 216..486 | 286..16 | 1355 | 100 | Minus |
ctp-RC | 4416 | CG6998-RC | 571..841 | 286..16 | 1355 | 100 | Minus |
ctp-RA | 1483 | CG6998-RA | 216..486 | 286..16 | 1355 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:30:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 4698295..4698459 | 180..16 | 825 | 100 | Minus |
2L | 23513712 | 2L | 1344616..1344886 | 286..16 | 740 | 84.9 | Minus |
X | 23542271 | X | 4691737..4691845 | 286..178 | 545 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 22:31:02 has no hits.
BS17710.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:07 Download gff for
BS17710.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6998-PA | 1..270 | 17..286 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 14:07:41 Download gff for
BS17710.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 208..486 | 16..294 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:09:24 Download gff for
BS17710.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 208..486 | 16..294 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:09:24 Download gff for
BS17710.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4691729..4691844 | 179..294 | 97 | -> | Minus |
X | 4698297..4698459 | 16..178 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 14:07:41 Download gff for
BS17710.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 4585762..4585877 | 179..294 | 97 | -> | Minus |
arm_X | 4592330..4592492 | 16..178 | 100 | | Minus |
BS17710.5prime Sequence
300 bp (300 high quality bases) assembled on 2007-05-29
> BS17710.5prime
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTTAAAAGCTTTCTAGACC
BS17710.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6998-PB | 270 | ctp-RB | 1..270 | 17..286 | 1350 | 100 | Plus |
CG6998-PD | 270 | ctp-RD | 1..270 | 17..286 | 1350 | 100 | Plus |
CG6998-PA | 270 | ctp-RA | 1..270 | 17..286 | 1350 | 100 | Plus |
CG6998-PC | 270 | ctp-RC | 1..270 | 17..286 | 1350 | 100 | Plus |
CG5450-PA | 270 | Cdlc2-RA | 79..218 | 95..234 | 250 | 87.1 | Plus |
CG5450-PB | 270 | Cdlc2-RB | 79..218 | 95..234 | 250 | 87.1 | Plus |
CG5450-PA | 270 | Cdlc2-RA | 1..59 | 17..75 | 145 | 89.8 | Plus |
CG5450-PB | 270 | Cdlc2-RB | 1..59 | 17..75 | 145 | 89.8 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:48:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ctp-RE | 4061 | CG6998-RE | 216..486 | 17..287 | 1355 | 100 | Plus |
ctp-RC | 4416 | CG6998-RC | 571..841 | 17..287 | 1355 | 100 | Plus |
ctp-RA | 1483 | CG6998-RA | 216..486 | 17..287 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:48:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 4698295..4698459 | 123..287 | 825 | 100 | Plus |
2L | 23513712 | 2L | 1344616..1344886 | 17..287 | 740 | 84.9 | Plus |
X | 23542271 | X | 4691737..4691845 | 17..125 | 545 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 13:48:13 has no hits.
BS17710.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:12 Download gff for
BS17710.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6998-PA | 1..270 | 17..286 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 19:01:42 Download gff for
BS17710.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 208..486 | 9..287 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:05:55 Download gff for
BS17710.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ctp-RA | 208..486 | 9..287 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:05:55 Download gff for
BS17710.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4691729..4691844 | 9..124 | 97 | -> | Plus |
X | 4698297..4698459 | 125..287 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 19:01:42 Download gff for
BS17710.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 4585762..4585877 | 9..124 | 97 | -> | Plus |
arm_X | 4592330..4592492 | 125..287 | 100 | | Plus |
BS17710.pep Sequence
Translation from 16 to 285
> BS17710.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG*
BS17710.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:45:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ctp-PE | 89 | CG6998-PE | 1..89 | 1..89 | 473 | 100 | Plus |
ctp-PC | 89 | CG6998-PC | 1..89 | 1..89 | 473 | 100 | Plus |
ctp-PA | 89 | CG6998-PA | 1..89 | 1..89 | 473 | 100 | Plus |
ctp-PB | 89 | CG6998-PB | 1..89 | 1..89 | 473 | 100 | Plus |
Cdlc2-PC | 89 | CG5450-PC | 1..89 | 1..89 | 469 | 98.9 | Plus |