Clone BS17710 Report

Search the DGRC for BS17710

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:177
Well:10
Vector:pDNR-Dual
Associated Gene/Transcriptctp-RA
Protein status:BS17710.pep: full length peptide match
Sequenced Size:302

Clone Sequence Records

BS17710.complete Sequence

302 bp assembled on 2010-02-09

GenBank Submission: KX805188

> BS17710.complete
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTTAAAAGCTTTCTAGACC
AT

BS17710.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 270 CG6998-PE 1..270 17..286 1350 100 Plus
ctp-RC 270 CG6998-PC 1..270 17..286 1350 100 Plus
ctp-RA 270 CG6998-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..486 17..287 1355 100 Plus
ctp-RC 4416 CG6998-RC 571..841 17..287 1355 100 Plus
ctp-RA 1483 CG6998-RA 216..486 17..287 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698459 123..287 825 100 Plus
2L 23513712 2L 1344616..1344886 17..287 740 84.9 Plus
X 23542271 X 4691737..4691845 17..125 545 100 Plus
Blast to na_te.dros performed on 2014-11-28 03:07:38 has no hits.

BS17710.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:26:59 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 1..270 17..286 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:15:20 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RB 329..596 17..284 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:36:01 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 216..483 17..284 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:26:59 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RB 321..599 9..287 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:43:26 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 216..483 17..284 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:43:26 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
X 4691737..4691844 17..124 100 -> Plus
X 4698297..4698456 125..284 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:36:01 Download gff for BS17710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585770..4585877 17..124 100 -> Plus
arm_X 4592330..4592489 125..284 100   Plus

BS17710.3prime Sequence

300 bp (300 high quality bases) assembled on 2007-05-29

> BS17710.3prime
ATGGTCTAGAAAGCTTTTAACCGCTCTTAAACAGTAAAATAGCCACCTGG
CCCAAATAGAAGTAAATAAAGTGGCGCGTCTCGTGTGTGACATACGATCC
AAAGTTGCGACCGACAATGCAATGCCATGTGGGATTGTATTTTTTGTCGA
ACTCCTTCTTGATGTAGGCCGCAATGTCCTTTTCAATGTTGTACTTCTCG
AGGGCCTGTGTCGCACAATCGACGGCATCCTGCTGCATCTCCTCGCTCAT
GTCGGCATTTTTAATCACGGCCTTGCGATCAGACATGTCGACTGATAACT

BS17710.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6998-PB 270 ctp-RB 1..270 286..17 1350 100 Minus
CG6998-PD 270 ctp-RD 1..270 286..17 1350 100 Minus
CG6998-PA 270 ctp-RA 1..270 286..17 1350 100 Minus
CG6998-PC 270 ctp-RC 1..270 286..17 1350 100 Minus
CG5450-PA 270 Cdlc2-RA 79..218 208..69 250 87.1 Minus
CG5450-PB 270 Cdlc2-RB 79..218 208..69 250 87.1 Minus
CG5450-PA 270 Cdlc2-RA 1..59 286..228 145 89.8 Minus
CG5450-PB 270 Cdlc2-RB 1..59 286..228 145 89.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..486 286..16 1355 100 Minus
ctp-RC 4416 CG6998-RC 571..841 286..16 1355 100 Minus
ctp-RA 1483 CG6998-RA 216..486 286..16 1355 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698459 180..16 825 100 Minus
2L 23513712 2L 1344616..1344886 286..16 740 84.9 Minus
X 23542271 X 4691737..4691845 286..178 545 100 Minus
Blast to na_te.dros performed on 2015-02-10 22:31:02 has no hits.

BS17710.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:07 Download gff for BS17710.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6998-PA 1..270 17..286 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 14:07:41 Download gff for BS17710.3prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..486 16..294 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:09:24 Download gff for BS17710.3prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..486 16..294 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:09:24 Download gff for BS17710.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4691729..4691844 179..294 97 -> Minus
X 4698297..4698459 16..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 14:07:41 Download gff for BS17710.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585762..4585877 179..294 97 -> Minus
arm_X 4592330..4592492 16..178 100   Minus

BS17710.5prime Sequence

300 bp (300 high quality bases) assembled on 2007-05-29

> BS17710.5prime
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTTAAAAGCTTTCTAGACC

BS17710.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6998-PB 270 ctp-RB 1..270 17..286 1350 100 Plus
CG6998-PD 270 ctp-RD 1..270 17..286 1350 100 Plus
CG6998-PA 270 ctp-RA 1..270 17..286 1350 100 Plus
CG6998-PC 270 ctp-RC 1..270 17..286 1350 100 Plus
CG5450-PA 270 Cdlc2-RA 79..218 95..234 250 87.1 Plus
CG5450-PB 270 Cdlc2-RB 79..218 95..234 250 87.1 Plus
CG5450-PA 270 Cdlc2-RA 1..59 17..75 145 89.8 Plus
CG5450-PB 270 Cdlc2-RB 1..59 17..75 145 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..486 17..287 1355 100 Plus
ctp-RC 4416 CG6998-RC 571..841 17..287 1355 100 Plus
ctp-RA 1483 CG6998-RA 216..486 17..287 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698459 123..287 825 100 Plus
2L 23513712 2L 1344616..1344886 17..287 740 84.9 Plus
X 23542271 X 4691737..4691845 17..125 545 100 Plus
Blast to na_te.dros performed on 2015-02-13 13:48:13 has no hits.

BS17710.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:23:12 Download gff for BS17710.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6998-PA 1..270 17..286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 19:01:42 Download gff for BS17710.5prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..486 9..287 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:05:55 Download gff for BS17710.5prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..486 9..287 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:05:55 Download gff for BS17710.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4691729..4691844 9..124 97 -> Plus
X 4698297..4698459 125..287 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 19:01:42 Download gff for BS17710.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585762..4585877 9..124 97 -> Plus
arm_X 4592330..4592492 125..287 100   Plus

BS17710.pep Sequence

Translation from 16 to 285

> BS17710.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG*

BS17710.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-PE 89 CG6998-PE 1..89 1..89 473 100 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 473 100 Plus
ctp-PA 89 CG6998-PA 1..89 1..89 473 100 Plus
ctp-PB 89 CG6998-PB 1..89 1..89 473 100 Plus
Cdlc2-PC 89 CG5450-PC 1..89 1..89 469 98.9 Plus