Clone Sequence Records
BS17915.complete Sequence
293 bp assembled on 2010-02-09
GenBank Submission: KX802990
> BS17915.complete
GAAGTTATCAGTCGACATGCACGCGACTGTCATCTCGGCTTTCGGGATAG
TATATCTACTGTTCCTGTTCCTGGGACATCTTTCTGCTCAAATTACCGTG
AGTCCAAGCACGTTCAATCCTCTTATGGTCGACAGCAAGCCGGAACCCGC
CACAAAAAACTCTTGGCACATTAATAATTATTATCCAAAAAGGTGGTTAA
TAAATATGAATAGTTCCGATAAGAAACTCAGACAATCCTACGATTACCGC
CCGCTGCACAATCCCCTCTATGGGTAAAAGCTTTCTAGACCAT
BS17915.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:59:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-RB | 261 | CG33494-PB | 1..261 | 17..277 | 1305 | 100 | Plus |
CG33494-RA | 261 | CG33494-PA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:00:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-RB | 849 | CG33494-RB | 55..315 | 17..277 | 1305 | 100 | Plus |
CG33494-RA | 751 | CG33494-RA | 55..315 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:59:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25494215..25494411 | 213..17 | 985 | 100 | Minus |
3R | 32079331 | 3R | 25494015..25494080 | 277..212 | 330 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:59:59 has no hits.
BS17915.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:38:10 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:14:04 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 55..313 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:32:27 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 55..313 | 17..275 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:38:10 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 51..321 | 9..283 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:40:24 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 55..313 | 17..275 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:40:24 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25494017..25494078 | 214..275 | 100 | <- | Minus |
3R | 25494215..25494411 | 17..213 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:32:27 Download gff for
BS17915.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21319739..21319800 | 214..275 | 100 | <- | Minus |
arm_3R | 21319937..21320133 | 17..213 | 100 | | Minus |
BS17915.3prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-30
> BS17915.3prime
ATGGTCTAGAAAGCTTTTACCCTTAGAGGGGATTGTGCAGCGGGCGGTAA
TCGTAGGATTGTCTGAGTTTCTTATCGGAACTATTCATATTTATTATCCA
CCTTTTTGGATAATAATTATTAATGTGCCAAGAGTTTTTTGTGGCGGGTT
CCGGCTTGCTGTCGACCATAAGAGGATTGAACGTGCTTGGACTCACGGTA
ATTTGAGCAGAAAGATGTCCCAGGAACAGGAACAGTAGATATACTATCCC
GAAAGCCGAGATGACAGTCGCGTGCATGTCGACTGATAACT
BS17915.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:47:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-PA | 261 | CG33494-RA | 1..261 | 277..17 | 1255 | 99.2 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:47:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-RB | 849 | CG33494-RB | 55..315 | 277..17 | 1275 | 99.2 | Minus |
CG33494-RA | 751 | CG33494-RA | 55..315 | 277..17 | 1275 | 99.2 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:47:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25494215..25494411 | 81..277 | 970 | 99.5 | Plus |
3R | 32079331 | 3R | 25494015..25494080 | 17..82 | 315 | 98.5 | Plus |
Blast to na_te.dros performed on 2015-02-13 06:47:46 has no hits.
BS17915.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:48:00 Download gff for
BS17915.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-PA | 1..261 | 17..277 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 00:03:37 Download gff for
BS17915.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 51..321 | 11..285 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:21:16 Download gff for
BS17915.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 51..321 | 11..285 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:21:16 Download gff for
BS17915.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25494215..25494415 | 81..285 | 97 | | Plus |
3R | 25494009..25494078 | 11..80 | 94 | <- | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 00:03:37 Download gff for
BS17915.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21319731..21319800 | 11..80 | 94 | <- | Plus |
arm_3R | 21319937..21320137 | 81..285 | 97 | | Plus |
BS17915.5prime Sequence
291 bp (291 high quality bases) assembled on 2007-05-30
> BS17915.5prime
GAAGTTATCCCTCTACATGCACGCGACTGTCATCTCGGCTTTCGGGATAG
TATATCTACTGTTCCTGTTCCTGGGACATCTTTCTGCTCAAATTACCGTG
AGTCCAAGCACGTTCAATCCTCTTATGGTCGACAGCAAGCCGGAACCCGC
CACAAAAAACTCTTGGCACATTAATAATTATTATCCAAAAAGGTGGTTAA
TAAATATGAATAGTTCCGATAAGAAACTCAGACAATCCTACGATTACCGC
CCGCTGCACAATCCCCTCTATGGGTAAAAGCTTTCTAGACC
BS17915.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:48:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-PA | 261 | CG33494-RA | 1..261 | 17..277 | 1305 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 13:59:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-RB | 849 | CG33494-RB | 55..315 | 17..277 | 1305 | 100 | Plus |
CG33494-RA | 751 | CG33494-RA | 55..315 | 17..277 | 1305 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 13:59:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25494215..25494411 | 213..17 | 985 | 100 | Minus |
3R | 32079331 | 3R | 25494015..25494080 | 277..212 | 330 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-05 13:59:50 has no hits.
BS17915.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:48:04 Download gff for
BS17915.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-PA | 1..261 | 17..277 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:10:58 Download gff for
BS17915.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 55..321 | 17..283 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 16:16:15 Download gff for
BS17915.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33494-RA | 55..321 | 17..283 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 16:16:15 Download gff for
BS17915.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25494009..25494078 | 214..283 | 95 | <- | Minus |
3R | 25494215..25494411 | 17..213 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:10:58 Download gff for
BS17915.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21319731..21319800 | 214..283 | 95 | <- | Minus |
arm_3R | 21319937..21320133 | 17..213 | 100 | | Minus |
BS17915.pep Sequence
Translation from 16 to 276
> BS17915.pep
MHATVISAFGIVYLLFLFLGHLSAQITVSPSTFNPLMVDSKPEPATKNSW
HINNYYPKRWLINMNSSDKKLRQSYDYRPLHNPLYG*
BS17915.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:59:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33494-PB | 86 | CG33494-PB | 1..86 | 1..86 | 465 | 100 | Plus |
CG33494-PA | 86 | CG33494-PA | 1..86 | 1..86 | 465 | 100 | Plus |