Clone BS17953 Report

Search the DGRC for BS17953

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:179
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG13067-RA
Protein status:BS17953.pep: Imported from assembly
Sequenced Size:272

Clone Sequence Records

BS17953.complete Sequence

272 bp assembled on 2010-02-09

GenBank Submission: KX803240

> BS17953.complete
GAAGTTATCAGTCGACATGTTCAAATACTTCGCTCTGTGCCTGTTCGCCA
TCGTGGCCTGCGTCTCTGCCAAGCCGGCGGTGCTCGCTTCTCCTCTGGCC
TACAGCGCCTACTCCGCTCCCTATGTGGCAGCTGCTCCTTACTCGGCTGC
CTACACCGCGGCATACACCGCTCCAGTGGCCGCCGCCTACTCCGCCTACA
CGTACCCCTATGCGTCCGCCTACTCCGCCTACCCCTATGCCGCCTACTAC
CGTTAAAAGCTTTCTAGACCAT

BS17953.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 240 CG13067-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..298 15..256 1210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271652 29..256 1140 100 Plus
Blast to na_te.dros performed on 2014-11-28 03:13:17 has no hits.

BS17953.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:04 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:16:47 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 37..269 22..254 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:38:27 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 64..296 22..254 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:04 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 24..275 9..261 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:45:29 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 64..296 22..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:45:29 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271650 29..254 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:38:27 Download gff for BS17953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264750 29..254 100   Plus

BS17953.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-30

> BS17953.5prime
GAAGTTATCACTCTACATGTTCAAATACTTCGCTCTGTGCCTGTTCGCCA
TCGTGGCCTGCGTCTCTGCCAAGCCGGCGGTGCTCGCTTCTCCTCTGGCC
TACAGCGCCTACTCCGCTCCCTATGTGGCAGCTGCTCCTTACTCGGCTGC
CTACACCGCGGCATACACCGCTCCAGTGGCCGCCGCCTACTCCGCCTACA
CGTACCCCTATGCGTCCGCCTACTCCGCCTACCCCTATGCCGCCTACTAC
CGTTAAAAGCTTTCTAGACC

BS17953.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 240 CG13067-RA 1..240 17..256 1200 100 Plus
CG13067-PB 624 CG13067-RB 397..624 29..256 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..298 15..256 1210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271652 29..256 1140 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:07:38 has no hits.

BS17953.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:52:29 Download gff for BS17953.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 19:11:36 Download gff for BS17953.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 57..302 15..261 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:06:39 Download gff for BS17953.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 57..302 15..261 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:06:39 Download gff for BS17953.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271656 29..261 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 19:11:36 Download gff for BS17953.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264756 29..261 99   Plus

BS17953.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-05-30

> BS17953.3prime
ATGGTCTAGAAAGCTTTTAACCGTAGTAGGCGGCATAGGGGTAGGCGGAG
TAGGCGGACGCATAGGGGTACGTGTAGGCGGAGTAGGCGGCGGCCACTGG
AGCGGTGTATGCCGCGGTGTAGGCAGCCGAGTAAGGAGCAGCTGCCACAT
AGGGAGCGGAGTAGGCGCTGTAGGCCAGAGGAGAAGCGAGCACCGCCGGC
TTGGCAGAGACGCAGGCCACGATGGCGAACAGGCACAGAGCGAAGTATTT
GAACATGTCGACTGATAACT

BS17953.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 240 CG13067-RA 1..240 256..17 1175 99.5 Minus
CG13067-PB 624 CG13067-RB 397..624 244..17 1115 99.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..298 258..17 1195 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271652 244..17 1125 99.6 Minus
Blast to na_te.dros performed on 2015-02-10 22:37:57 has no hits.

BS17953.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-08-06 11:52:24 Download gff for BS17953.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-PA 1..240 17..256 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 14:08:39 Download gff for BS17953.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..302 12..264 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 00:03:44 Download gff for BS17953.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..302 12..264 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 00:03:44 Download gff for BS17953.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271656 12..244 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 14:08:39 Download gff for BS17953.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264756 12..244 98   Minus

BS17953.pep Sequence

Translation from 122 to 272

> BS17953.pep
MWQLLLTRLPTPRHTPLQWPPPTPPTRTPMRPPTPPTPMPPTTVKSFLDH
Sequence BS17953.pep has no blast hits.