Clone BS19514 Report

Search the DGRC for BS19514

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:195
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptTim9a-RA
Protein status:BS19514.pep: full length peptide match
Sequenced Size:320

Clone Sequence Records

BS19514.complete Sequence

320 bp assembled on 2011-01-27

GenBank Submission: KX801740

> BS19514.complete
GAAGTTATCAGTCGACATGGCTAAGACACCGGAAAACATAGCCATCGATC
AGTTGGACAAGGATCAAATTAAGACGTTTTCCGACTTCCTAATGTCCTAC
AACAAACTGTCCGAGACGTGCTTCACAGATTGCATACGCGACTTTACAAC
GCGGGATGTTAAGGATTCCGAGGAGAAGTGCTCGCTGAACTGCATGGAAA
AGTATCTGAAGATGAACCAACGCGTCTCGCAGCGTTTCCAGGAGTTCCAG
GTTATTGCCCACGAGAACGCACTGGCCATGGCTCAAAAGACTGGCAAACT
TTAGAAGCTTTCTAGACCAT

BS19514.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-RB 288 CG1660-PB 1..288 17..304 1440 100 Plus
Tim9a-RA 288 CG1660-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-RB 461 CG1660-RB 73..360 17..304 1440 100 Plus
Tim9a-RA 516 CG1660-RA 128..415 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13385659..13385792 171..304 670 100 Plus
X 23542271 X 13385499..13385596 76..173 490 100 Plus
X 23542271 X 13385337..13385396 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:48:05 has no hits.

BS19514.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:04 Download gff for BS19514.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 128..415 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:53 Download gff for BS19514.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 128..415 17..304 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:00 Download gff for BS19514.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 128..415 17..304 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:00 Download gff for BS19514.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385337..13385396 17..76 100 -> Plus
X 13385500..13385595 77..172 100 -> Plus
X 13385661..13385792 173..304 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:53 Download gff for BS19514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13279370..13279429 17..76 100 -> Plus
arm_X 13279533..13279628 77..172 100 -> Plus
arm_X 13279694..13279825 173..304 100   Plus

BS19514.pep Sequence

Translation from 16 to 303

> BS19514.pep
MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD
SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL*

BS19514.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-PB 95 CG1660-PB 1..95 1..95 493 100 Plus
Tim9a-PA 95 CG1660-PA 1..95 1..95 493 100 Plus