BS19514.complete Sequence
320 bp assembled on 2011-01-27
GenBank Submission: KX801740
> BS19514.complete
GAAGTTATCAGTCGACATGGCTAAGACACCGGAAAACATAGCCATCGATC
AGTTGGACAAGGATCAAATTAAGACGTTTTCCGACTTCCTAATGTCCTAC
AACAAACTGTCCGAGACGTGCTTCACAGATTGCATACGCGACTTTACAAC
GCGGGATGTTAAGGATTCCGAGGAGAAGTGCTCGCTGAACTGCATGGAAA
AGTATCTGAAGATGAACCAACGCGTCTCGCAGCGTTTCCAGGAGTTCCAG
GTTATTGCCCACGAGAACGCACTGGCCATGGCTCAAAAGACTGGCAAACT
TTAGAAGCTTTCTAGACCAT
BS19514.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-RB | 288 | CG1660-PB | 1..288 | 17..304 | 1440 | 100 | Plus |
Tim9a-RA | 288 | CG1660-PA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-RB | 461 | CG1660-RB | 73..360 | 17..304 | 1440 | 100 | Plus |
Tim9a-RA | 516 | CG1660-RA | 128..415 | 17..304 | 1440 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 13385659..13385792 | 171..304 | 670 | 100 | Plus |
X | 23542271 | X | 13385499..13385596 | 76..173 | 490 | 100 | Plus |
X | 23542271 | X | 13385337..13385396 | 17..76 | 300 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:48:05 has no hits.
BS19514.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:05:04 Download gff for
BS19514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 128..415 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:44:53 Download gff for
BS19514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 128..415 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:04:00 Download gff for
BS19514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 128..415 | 17..304 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:04:00 Download gff for
BS19514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 13385337..13385396 | 17..76 | 100 | -> | Plus |
X | 13385500..13385595 | 77..172 | 100 | -> | Plus |
X | 13385661..13385792 | 173..304 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:44:53 Download gff for
BS19514.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 13279370..13279429 | 17..76 | 100 | -> | Plus |
arm_X | 13279533..13279628 | 77..172 | 100 | -> | Plus |
arm_X | 13279694..13279825 | 173..304 | 100 | | Plus |
BS19514.pep Sequence
Translation from 16 to 303
> BS19514.pep
MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD
SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL*
BS19514.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-PB | 95 | CG1660-PB | 1..95 | 1..95 | 493 | 100 | Plus |
Tim9a-PA | 95 | CG1660-PA | 1..95 | 1..95 | 493 | 100 | Plus |