Clone BS19516 Report

Search the DGRC for BS19516

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:195
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptMtnB-RA
Protein status:BS19516.pep: full length peptide match
Sequenced Size:164

Clone Sequence Records

BS19516.complete Sequence

164 bp assembled on 2011-01-27

GenBank Submission: KX805329

> BS19516.complete
GAAGTTATCAGTCGACATGGTTTGCAAGGGTTGTGGAACAAACTGCCAGT
GCTCGGCCCAAAAGTGCGGGGACAACTGCGCCTGCAACAAGGATTGCCAG
TGCGTTTGCAAGAATGGGCCCAAGGACCAGTGCTGCAGCAACAAATAAAA
GCTTTCTAGACCAT

BS19516.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-RC 132 CG4312-PC 1..132 17..148 660 100 Plus
MtnB-RB 132 CG4312-PB 1..132 17..148 660 100 Plus
MtnB-RA 132 CG4312-PA 1..132 17..148 660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-RC 456 CG4312-RC 89..220 17..148 660 100 Plus
MtnB-RB 448 CG4312-RB 217..348 17..148 660 100 Plus
MtnB-RA 320 CG4312-RA 89..220 17..148 660 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20503338..20503448 148..38 540 99.1 Minus
3R 32079331 3R 20535108..20535202 42..136 235 83.2 Plus
3R 32079331 3R 20360450..20360525 62..137 200 84.2 Plus
Blast to na_te.dros performed on 2014-11-26 15:43:49 has no hits.

BS19516.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:04:54 Download gff for BS19516.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 70..192 17..139 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:43:04 Download gff for BS19516.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 89..211 17..139 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:25 Download gff for BS19516.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 89..211 17..139 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:25 Download gff for BS19516.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20503347..20503444 42..139 100 <- Minus
3R 20503506..20503530 17..41 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:43:04 Download gff for BS19516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16329069..16329166 42..139 100 <- Minus
arm_3R 16329228..16329252 17..41 100   Minus

BS19516.pep Sequence

Translation from 16 to 147

> BS19516.pep
MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNK*

BS19516.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-PC 43 CG4312-PC 1..43 1..43 271 100 Plus
MtnB-PB 43 CG4312-PB 1..43 1..43 271 100 Plus
MtnB-PA 43 CG4312-PA 1..43 1..43 271 100 Plus
MtnC-PA 43 CG5097-PA 1..43 1..43 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 1..43 221 79.1 Plus