Clone BS19528 Report

Search the DGRC for BS19528

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:195
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG13919-RA
Protein status:BS19528.pep: full length peptide match
Sequenced Size:428

Clone Sequence Records

BS19528.complete Sequence

428 bp assembled on 2011-01-27

GenBank Submission: KX804338

> BS19528.complete
GAAGTTATCAGTCGACATGACACTGGCACACCGGGCGCTCTTCACTTGGT
TTATCGTCCTGGTCTTCCTGATTCTTCTGTGTCTCCGCCTGGACCCACGC
ACCACCTGGAATTGGTTCGTCACCTTTACGCCACTCTGGTTCTTCGATGT
GATCATTATCATCTACGTGATCATTAAATTTATCCGCAAGTGGCGGAACC
TAACCTGCCTGACGGATCTCCTGTTCCTCTACAAATGGAACATTGCCGGC
GTCCTGCTGACCATCGCCTCCCAAGTGATGATCTGCCTAACGCTGGAGTA
CCCGCAACAGATTCCCATATACGTGACCGTTGCCCCGGTCATCCTGCTGC
TGAGCACCGCCATCTTCTATGTTGGCAGCAGGCTGGGAAAACGAGAGGGC
TGGATACAGTAAAAGCTTTCTAGACCAT

BS19528.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-RA 396 CG13919-PA 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-RA 517 CG13919-RA 76..471 17..412 1980 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1645542..1645937 17..412 1980 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:55:58 has no hits.

BS19528.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-28 16:04:37 Download gff for BS19528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 76..469 17..410 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:06:21 Download gff for BS19528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 76..469 17..410 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:52:07 Download gff for BS19528.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 76..469 17..410 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:52:07 Download gff for BS19528.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1645542..1645935 17..410 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:06:21 Download gff for BS19528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1645542..1645935 17..410 100   Plus

BS19528.pep Sequence

Translation from 16 to 411

> BS19528.pep
MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIY
VIIKFIRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIP
IYVTVAPVILLLSTAIFYVGSRLGKREGWIQ*

BS19528.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-PA 131 CG13919-PA 1..131 1..131 693 100 Plus