Clone BS19625 Report

Search the DGRC for BS19625

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:196
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG12912-RA
Protein status:BS19625.pep: full length peptide match
Sequenced Size:371

Clone Sequence Records

BS19625.complete Sequence

371 bp assembled on 2011-01-04

GenBank Submission: KX802659

> BS19625.complete
GAAGTTATCAGTCGACATGTGGGAAATCAACAGCAACATTGGCACATCCA
CATCCAGATCCAGAGGCACACTTCCAACTGTTTTGACGTGGTCGGGTTCC
AATGGCGCTGACACTACCGAATGCTGCAGCGCAGCCTTGCAGCCATCCAG
CGGCGACGCGTTGCATGTGCAGCAGCAACAGCAACAGCAGCAGCAACATC
AGCAGCAGCAGCAGCAGCAACAGCAACAGCAGCAACAACAGCAGCAGCAG
CAGGATACGAAAACGAGGATGACAACGACCACAGGCAAACGCGGAGGACA
CAGATACAGAAGCAGGCTCAGTCACCGAAGCACAGCAACAATTGCTGCAT
ATTAGAAGCTTTCTAGACCAT

BS19625.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-RB 339 CG12912-PB 1..339 17..355 1695 100 Plus
CG12912-RA 339 CG12912-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-RB 6466 CG12912-RB 396..734 17..355 1695 100 Plus
CG12912-RA 1142 CG12912-RA 396..734 17..355 1695 100 Plus
Hr46-RE 6385 CG33183-RE 396..734 17..355 1695 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10233874..10234212 355..17 1695 100 Minus
Blast to na_te.dros performed 2014-11-26 15:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 656..728 254..182 185 72.6 Minus

BS19625.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 08:55:26 Download gff for BS19625.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 365..703 17..355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:34:42 Download gff for BS19625.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RB 396..734 17..355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:10 Download gff for BS19625.complete
Subject Subject Range Query Range Percent Splice Strand
Hr46-RE 396..734 17..355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:10 Download gff for BS19625.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10233874..10234212 17..355 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:34:42 Download gff for BS19625.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6121379..6121717 17..355 100   Minus

BS19625.pep Sequence

Translation from 16 to 354

> BS19625.pep
MWEINSNIGTSTSRSRGTLPTVLTWSGSNGADTTECCSAALQPSSGDALH
VQQQQQQQQQHQQQQQQQQQQQQQQQQQQDTKTRMTTTTGKRGGHRYRSR
LSHRSTATIAAY*

BS19625.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-PB 112 CG12912-PB 1..112 1..112 585 100 Plus
CG12912-PA 112 CG12912-PA 1..112 1..112 585 100 Plus
CHES-1-like-PC 1267 CG12690-PC 256..334 21..97 158 50.6 Plus
CHES-1-like-PD 1268 CG12690-PD 256..334 21..97 158 50.6 Plus
CHES-1-like-PB 1268 CG12690-PB 256..334 21..97 158 50.6 Plus