Clone BS19710 Report

Search the DGRC for BS19710

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:197
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG14321-RA
Protein status:BS19710.pep: gold
Sequenced Size:398

Clone Sequence Records

BS19710.complete Sequence

398 bp assembled on 2011-01-04

GenBank Submission: KX802084

> BS19710.complete
GAAGTTATCAGTCGACATGACGCGTCCTGCGATTTTCCTCGTTGTCTGCT
CAATAACTCTGCTTAATTCCGTCAATGGCTACAAGGAGATCCATGGAATG
AATGGCAAGCTGTTTCCGAAGGCGGCGACGTTTAATTTTCCCGAATATGC
TTACAAGGAGACCAGCAAAAATGAAATCACTTACCACGAACTGGAGGTGA
CCTGTGACCAGCACGCCCAGTGCATTGGCCTTAGTCCGGTGGGCGTGGCC
AAGATCAACTGCATCCGACAGTGCATTTCGCCATCGTGCTACCAGGACAT
CTATGCCTTCAACGAGCTGGAGGAGGGCGAAATCGACGCCAGGCTGAACT
CCTTTAAGGGATGCGTTATCCAACGCATGTAGAAGCTTTCTAGACCAT

BS19710.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-RA 366 CG14321-PA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-RA 702 CG14321-RA 41..410 17..386 1835 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17733876..17734089 173..386 1055 99.5 Plus
3R 32079331 3R 17733638..17733794 17..173 785 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:44:44 has no hits.

BS19710.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 08:55:28 Download gff for BS19710.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 39..404 17..382 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:34:49 Download gff for BS19710.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 41..406 17..382 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:19:22 Download gff for BS19710.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 41..406 17..382 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:19:22 Download gff for BS19710.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17733638..17733793 17..172 100 -> Plus
3R 17733876..17734085 173..382 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:34:49 Download gff for BS19710.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13559360..13559515 17..172 100 -> Plus
arm_3R 13559598..13559807 173..382 100   Plus

BS19710.pep Sequence

Translation from 16 to 381

> BS19710.pep
MTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYKETS
KNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYAFNE
LEEGEIDARLNSFKGCVIQRM*

BS19710.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-PA 121 CG14321-PA 1..121 1..121 647 100 Plus