BS19727.complete Sequence
302 bp assembled on 2011-01-04
GenBank Submission: KX802987
> BS19727.complete
GAAGTTATCAGTCGACATGACCAAGGGAACCACTAGTTTTGGAAAGCGCC
ACAACAAGACGCACACCATCTGTCGCCGGTGCGGCAACTCGTCGTACCAT
CTGCAGAAATCGAAGTGCTCCCAGTGCGGCTATCCTGCGGCCAAGACCCG
AAGCTTCAACTGGTCCCGAAAGGCCAAGGGTCGCAAGGCGCAGGGAACGG
GAAGGATGCGGTACCTCAAGAATCTGCGCCGTCGTTTTCGCAACGGATTG
CGTGAAGGAGGTGCCGCTAAGAAAAAAACCAACTAAAAGCTTTCTAGACC
AT
BS19727.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:46:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37b-RA | 270 | CG9873-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
| RpL37a-RB | 282 | CG9091-PB | 1..233 | 17..249 | 265 | 74.2 | Plus |
| RpL37a-RA | 282 | CG9091-PA | 1..233 | 17..249 | 265 | 74.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:46:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37b-RA | 422 | CG9873-RA | 106..375 | 17..286 | 1350 | 100 | Plus |
| RpL37a-RB | 565 | CG9091-RB | 114..346 | 17..249 | 265 | 74.2 | Plus |
| RpL37a-RA | 1296 | CG9091-RA | 114..346 | 17..249 | 265 | 74.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:46:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 23100104..23100373 | 286..17 | 1350 | 100 | Minus |
| X | 23542271 | X | 15138989..15139115 | 145..19 | 215 | 78 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:46:44 has no hits.
BS19727.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 08:55:42 Download gff for
BS19727.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37b-RA | 87..341 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:14 Download gff for
BS19727.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37b-RA | 106..360 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:20:05 Download gff for
BS19727.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| RpL37b-RA | 106..360 | 17..271 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:20:05 Download gff for
BS19727.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 23100119..23100373 | 17..271 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:14 Download gff for
BS19727.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 18987642..18987896 | 17..271 | 100 | | Minus |
BS19727.pep Sequence
Translation from 16 to 285
> BS19727.pep
MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWS
RKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKTN*
BS19727.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:48:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| RpL37b-PA | 89 | CG9873-PA | 1..89 | 1..89 | 485 | 100 | Plus |
| RpL37a-PB | 93 | CG9091-PB | 1..87 | 1..87 | 372 | 77 | Plus |
| RpL37a-PA | 93 | CG9091-PA | 1..87 | 1..87 | 372 | 77 | Plus |
