BS19788.complete Sequence
341 bp assembled on 2011-01-04
GenBank Submission: KX805699
> BS19788.complete
GAAGTTATCAGTCGACATGTGCCAAACAATGCGTTGCATCCTGGTTGCCT
GTGTGGCCCTTGCCCTCCTAGCCGCCGGCTGCCGAGTGGAGGCGTCCAAC
TCCAGACCTCCGCGAAAGAACGATGTCAACACTATGGCTGATGCCTACAA
GTTCCTGCAGGATCTGGACACCTACTACGGCGACAGAGCCCGCGTTCGGT
TCGGAAAGCGCGGATCGCTGATGGATATCCTGAGGAATCACGAGATGGAC
AACATAAATCTAGGAAAAAATGCCAACAATGGAGGAGAATTTGCTCGCGG
TTTTAATGAGGAGGAGATATTCTAAAAGCTTTCTAGACCAT
BS19788.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:52:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-RC | 309 | CG10342-PC | 1..309 | 17..325 | 1545 | 100 | Plus |
NPF-RB | 309 | CG10342-PB | 1..309 | 17..325 | 1545 | 100 | Plus |
NPF-RA | 309 | CG10342-PA | 1..309 | 17..325 | 1545 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:52:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-RC | 579 | CG10342-RC | 86..395 | 17..326 | 1550 | 100 | Plus |
NPF-RB | 518 | CG10342-RB | 25..334 | 17..326 | 1550 | 100 | Plus |
NPF-RA | 569 | CG10342-RA | 76..385 | 17..326 | 1550 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:52:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 16610779..16611055 | 17..293 | 1385 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:52:10 has no hits.
BS19788.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 08:55:59 Download gff for
BS19788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
npf-RA | 75..381 | 17..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:04 Download gff for
BS19788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
npf-RA | 76..382 | 17..323 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:21:53 Download gff for
BS19788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
NPF-RA | 76..382 | 17..323 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:21:53 Download gff for
BS19788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 16610779..16611054 | 17..292 | 100 | -> | Plus |
3R | 16611108..16611138 | 293..323 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:04 Download gff for
BS19788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12436501..12436776 | 17..292 | 100 | -> | Plus |
arm_3R | 12436830..12436860 | 293..323 | 100 | | Plus |
BS19788.pep Sequence
Translation from 16 to 324
> BS19788.pep
MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL
DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE
IF*
BS19788.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:49:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-PC | 102 | CG10342-PC | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PB | 102 | CG10342-PB | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PA | 102 | CG10342-PA | 1..102 | 1..102 | 537 | 100 | Plus |