BS19959.complete Sequence
287 bp assembled on 2011-01-07
GenBank Submission: KX805506
> BS19959.complete
GAAGTTATCAGTCGACATGCTGAATTCCCTGGACAACCTGGAGGATTGCG
AGGAGATCTACACTCGCGAGATGCACGATATGAACATTGGCGTTGGAGAA
GGAACCGTTCCATGCTGGGTGTACCTGCTGCAGAAGTACCCGGAGAACCT
ACTTAGTCTGCGCTACTTGTCCAGCTACGAGAACTCAACCACCCATCCAT
ACATTATGCGCCATCGCCGCACCCACAAGCATCCGGCCCAGGACGACCTC
ACCTACGAGGCCCAGAACTAAAAGCTTTCTAGACCAT
BS19959.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:22:00
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Tina-1-RB | 255 | CG2803-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
| Tina-1-RA | 504 | CG2803-PA | 250..504 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:22:01
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Tina-1-RB | 1429 | CG2803-RB | 914..1168 | 17..271 | 1275 | 100 | Plus |
| Tina-1-RA | 914 | CG2803-RA | 399..653 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:21:58
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 24940886..24941055 | 271..102 | 850 | 100 | Minus |
| 2R | 25286936 | 2R | 24941122..24941207 | 102..17 | 430 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:21:59 has no hits.
BS19959.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:27 Download gff for
BS19959.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Tina-1-RB | 903..1155 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:01 Download gff for
BS19959.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Tina-1-RA | 399..651 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:39:40 Download gff for
BS19959.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Tina-1-RA | 399..651 | 17..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:39:40 Download gff for
BS19959.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 24940888..24941054 | 103..269 | 100 | <- | Minus |
| 2R | 24941122..24941207 | 17..102 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:01 Download gff for
BS19959.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 20828411..20828577 | 103..269 | 100 | <- | Minus |
| arm_2R | 20828645..20828730 | 17..102 | 100 | | Minus |
BS19959.pep Sequence
Translation from 16 to 270
> BS19959.pep
MLNSLDNLEDCEEIYTREMHDMNIGVGEGTVPCWVYLLQKYPENLLSLRY
LSSYENSTTHPYIMRHRRTHKHPAQDDLTYEAQN*
BS19959.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Tina-1-PB | 84 | CG2803-PB | 1..84 | 1..84 | 462 | 100 | Plus |
| Tina-1-PA | 167 | CG2803-PA | 84..167 | 1..84 | 462 | 100 | Plus |
| CG2811-PA | 157 | CG2811-PA | 81..157 | 1..80 | 139 | 38.8 | Plus |
