Clone BS19964 Report

Search the DGRC for BS19964

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:199
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG33774-RA
Protein status:BS19964.pep: gold
Sequenced Size:155

Clone Sequence Records

BS19964.complete Sequence

155 bp assembled on 2011-01-07

GenBank Submission: KX806242

> BS19964.complete
GAAGTTATCAGTCGACATGATCACCGACGTGCAATTGGCCATTTTCTCCA
ACGTTCTGGGCGTATTTCTGTTCCTGCTGGTGGTTGCCTATCATTATATT
AATGCCAATACCGGAAAGCCCAGCGCCAAGGCAAAATGAAAGCTTTCTAG
ACCAT

BS19964.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-RA 123 CG33774-PA 1..123 17..139 600 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-RA 310 CG33774-RA 94..216 17..139 600 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9399947..9400048 118..17 510 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:23:17 has no hits.

BS19964.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:32 Download gff for BS19964.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 69..184 17..132 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:18 Download gff for BS19964.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 94..209 17..132 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:11 Download gff for BS19964.complete
Subject Subject Range Query Range Percent Splice Strand
CG33774-RA 94..209 17..132 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:11 Download gff for BS19964.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9399943..9400048 17..123 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:18 Download gff for BS19964.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5287448..5287553 17..123 97   Minus

BS19964.pep Sequence

Translation from 16 to 138

> BS19964.pep
MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGKPSAKAK*

BS19964.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG33774-PA 40 CG33774-PA 1..40 1..40 198 100 Plus