Clone BS19981 Report

Search the DGRC for BS19981

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:199
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG13038-RA
Protein status:BS19981.pep: full length peptide match
Sequenced Size:317

Clone Sequence Records

BS19981.complete Sequence

317 bp assembled on 2011-01-07

GenBank Submission: KX801194

> BS19981.complete
GAAGTTATCAGTCGACATGCGGCATCTGTTGCTTCTGGCCTTAGTTTACA
TGGCTCTGGTTTTGGCCAAACCGGCGACGGAGGCGCCTCGTCTGCTCATC
GATTCAGCGCCCTCAGTGGTCTCCTACCAGGGTTCCTCACAGGCCCAAAC
CCGCTTCGTCATCGCGCCCATGGGCCGATCATTGGGCTACGTGGAGCCCA
CCAATCTCAATCGAACCTTTCACACGAAGGCAACGCAGGAGGGAGGCGCC
ACCGGCTACGAGCAGCTCAATCTGAGTCCGGTCTACGTGCCGGGTAGCTA
GAAGCTTTCTAGACCAT

BS19981.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-RA 285 CG13038-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-RA 509 CG13038-RA 165..450 16..301 1430 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16327317..16327590 301..28 1370 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:24:04 has no hits.

BS19981.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:35 Download gff for BS19981.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 143..427 17..301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:32 Download gff for BS19981.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 166..450 17..301 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:29 Download gff for BS19981.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 166..450 17..301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:29 Download gff for BS19981.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16327317..16327590 28..301 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:32 Download gff for BS19981.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16320417..16320690 28..301 100   Minus

BS19981.pep Sequence

Translation from 16 to 300

> BS19981.pep
MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA
PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGS*

BS19981.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-PA 94 CG13038-PA 1..94 1..94 472 100 Plus