Clone BS19986 Report

Search the DGRC for BS19986

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:199
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG42339-RA
Protein status:BS19986.pep: full length peptide match
Sequenced Size:374

Clone Sequence Records

BS19986.complete Sequence

374 bp assembled on 2011-01-07

GenBank Submission: KX805292

> BS19986.complete
GAAGTTATCAGTCGACATGTCGTTGCTGCTGCTCCTTTTGGCCGTCATCC
TGCCGCAGCGGCAGCTTCTGCCCTTCGTATCCGGAGGGTCCTGCCGGGAG
GCGCAGCTCTGCTGCAACGGCCGCGACTCGTCCTGCGTCGTCCAGAAGGC
TCCCATCAATGCCATCATCGAGGATCTCAGCGACAAGCCCTGCTACTGTG
ACCACGCCTGCCTCAAGCTCGGCGATTGCTGCGACGACTTCAAGGATCAC
TGTGGAGGAGTCTTTAGGCGCCGAAAACTGAAGTCCATCCATCTGGCAGC
CGGAAACTGCCATAAGCACGGATCCGTTAAGAATGCAGCTGCAATGGCAA
TGATTTGAAAGCTTTCTAGACCAT

BS19986.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-RA 342 CG42339-PA 1..342 17..358 1710 100 Plus
CG42339-RB 1188 CG42339-PB 1..241 17..257 1205 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-RA 656 CG42339-RA 97..438 17..358 1710 100 Plus
CG42339-RB 2354 CG15204-RA 145..385 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11037474..11037715 258..17 1210 100 Minus
X 23542271 X 11036108..11036210 358..256 515 100 Minus
Blast to na_te.dros performed 2014-11-26 15:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6802..6931 136..8 116 57.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6846 70..18 113 73.6 Minus

BS19986.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:37 Download gff for BS19986.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 97..437 17..357 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:38 Download gff for BS19986.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 97..437 17..357 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:40 Download gff for BS19986.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 97..437 17..357 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:40 Download gff for BS19986.complete
Subject Subject Range Query Range Percent Splice Strand
X 11036109..11036208 258..357 100 <- Minus
X 11037475..11037715 17..257 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:38 Download gff for BS19986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10930142..10930241 258..357 100 <- Minus
arm_X 10931508..10931748 17..257 100   Minus

BS19986.pep Sequence

Translation from 16 to 357

> BS19986.pep
MSLLLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAI
IEDLSDKPCYCDHACLKLGDCCDDFKDHCGGVFRRRKLKSIHLAAGNCHK
HGSVKNAAAMAMI*

BS19986.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-PA 113 CG12626-PA 1..113 1..113 611 100 Plus
CG42339-PB 395 CG15204-PA 1..80 1..80 441 100 Plus