Clone BS19987 Report

Search the DGRC for BS19987

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:199
Well:87
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)neo43-RB
Protein status:BS19987.pep: full length peptide match
Sequenced Size:350

Clone Sequence Records

BS19987.complete Sequence

350 bp assembled on 2011-01-07

GenBank Submission: KX803012

> BS19987.complete
GAAGTTATCAGTCGACATGTCTCTCGTGGATAAATTAAACTATTACAGCA
CACGAAAATCGTTCAAATATGGCATACCCTTCCTCATCATGATGGTGGCT
GGCTCCTTTGGACTGCAGCAGTTCTCCAACCTCAGGTATCAGTACGCCAA
GAAGCAGCCGGTAACGCCGGAGGAGATGAAAAAGTACGGCGTAAGCATGA
AAAACCGCAAGGATGTGACGTTGGAGTCGGAGTACGACAAAGTCAAGTCC
GTGGACATAGAGAACTGGGAGAACAAACGCGGTCCACGTCCCTGGGAGGA
GCAGGAAGATCAGCCGACGACAGCGAAGCACTAGAAGCTTTCTAGACCAT

BS19987.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-RC 246 CG14865-PC 1..246 89..334 1230 100 Plus
l(3)neo43-RB 246 CG14865-PB 1..246 89..334 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-RC 627 CG14865-RC 48..366 17..335 1595 100 Plus
l(3)neo43-RB 460 CG14865-RB 48..366 17..335 1595 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15278242..15278444 335..133 1015 100 Minus
3R 32079331 3R 15278502..15278621 136..17 600 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:24:40 has no hits.

BS19987.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:37 Download gff for BS19987.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 9..326 17..334 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:40 Download gff for BS19987.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 9..326 17..334 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:43 Download gff for BS19987.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 48..365 17..334 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:43 Download gff for BS19987.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15278243..15278443 134..334 100 -> Minus
3R 15278502..15278621 17..133 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:40 Download gff for BS19987.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11103965..11104165 134..334 100 -> Minus
arm_3R 11104224..11104343 17..133 97   Minus

BS19987.pep Sequence

Translation from 16 to 333

> BS19987.pep
MSLVDKLNYYSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAKKQPVT
PEEMKKYGVSMKNRKDVTLESEYDKVKSVDIENWENKRGPRPWEEQEDQP
TTAKH*

BS19987.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-PC 81 CG14865-PC 1..81 25..105 434 100 Plus
l(3)neo43-PB 81 CG14865-PB 1..81 25..105 434 100 Plus