Clone BS19988 Report

Search the DGRC for BS19988

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:199
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG15036-RA
Protein status:BS19988.pep: gold
Sequenced Size:251

Clone Sequence Records

BS19988.complete Sequence

251 bp assembled on 2011-01-07

GenBank Submission: KX801711

> BS19988.complete
GAAGTTATCAGTCGACATGAGGCAATCCATAAAGCACATATTCGCACTGT
TGGTTGCCCTGGAGTGTTTAAGCCTTGGCGACACGGCGCCCATCGGTGAG
CATCCGGATCATGCCGGATGTATACGGATAACGATCATCAAGCGACCATT
GGCCACCACCACCACCACGACAACAACAACAACTACAACCACAACAACCA
CTACAACCAGAGCAACAACCACGGCCGCTGGTTAAAAGCTTTCTAGACCA
T

BS19988.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-RA 219 CG15036-PA 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-RA 316 CG15036-RA 31..251 17..237 1105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7424592..7424812 237..17 1105 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:24:50 has no hits.

BS19988.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:38 Download gff for BS19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 31..247 17..233 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:43 Download gff for BS19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 31..247 17..233 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:47 Download gff for BS19988.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 31..247 17..233 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:47 Download gff for BS19988.complete
Subject Subject Range Query Range Percent Splice Strand
X 7424596..7424812 17..233 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:43 Download gff for BS19988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7318629..7318845 17..233 100   Minus

BS19988.pep Sequence

Translation from 16 to 234

> BS19988.pep
MRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKRPLATTTT
TTTTTTTTTTTTTTRATTTAAG*

BS19988.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-PA 72 CG15036-PA 1..72 1..72 366 100 Plus