Clone BS20107 Report

Search the DGRC for BS20107

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCpr64Ab-RA
Protein status:BS20107.pep: gold
Sequenced Size:395

Clone Sequence Records

BS20107.complete Sequence

395 bp assembled on 2011-01-07

GenBank Submission: KX800593

> BS20107.complete
GAAGTTATCAGTCGACATGGCCCTGATCAAGATCACCCTCATCTGCTGCG
CTCTGATCGCCGCCATCGAGTGCGCCCTGCTCCCAGCTGCTGTTCCAGTG
GGAGTGCCCCTCAACACGGAGGTGGATCCACATCCGCAGTACGCGTTCGC
CTATAATGTGCAGGATGCCCTTACCGGGGACAGCAAGAGCCAGCAGGAGG
TGCGGGATGGAGATGTGGTCAAGGGCTCCTACTCGGTGGTCGATGCCGAT
GGTTCACTGCGCACCGTCTTCTACACCGCCGATCCCATCAACGGTTTCAA
TGCGGTGGTGCAGCGAGGACCAGTTCCGGTGGCTGCTCGCCCATTGGTGG
CTCCAGTGGCTGCTCCAATCTTGGGCTAAAAGCTTTCTAGACCAT

BS20107.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-RA 363 CG15007-PA 1..363 17..379 1815 100 Plus
Cpr64Ad-RB 744 CG1259-PB 418..609 122..313 270 76 Plus
Ccp84Ad-RA 600 CG2341-PA 169..344 125..300 235 75.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-RA 552 CG15007-RA 68..431 16..379 1820 100 Plus
Cpr64Ad-RB 961 CG1259-RB 489..680 122..313 270 76 Plus
Ccp84Ad-RA 735 CG2341-RA 235..410 125..300 235 75.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4211001..4211350 379..30 1750 100 Minus
3L 28110227 3L 4215942..4216133 122..313 270 76 Plus
3R 32079331 3R 6693027..6693202 125..300 235 75.6 Plus
2L 23513712 2L 9932724..9932862 311..173 230 77.7 Minus
3L 28110227 3L 1841032..1841124 283..191 210 81.7 Minus
3R 32079331 3R 6689785..6689960 300..125 205 74.4 Minus
2L 23513712 2L 10055335..10055437 223..325 185 78.6 Plus
Blast to na_te.dros performed on 2014-11-26 15:41:32 has no hits.

BS20107.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:30:49 Download gff for BS20107.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 69..429 17..377 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:15 Download gff for BS20107.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 69..429 17..377 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:47:06 Download gff for BS20107.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 69..429 17..377 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:47:06 Download gff for BS20107.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4211003..4211348 32..377 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:15 Download gff for BS20107.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4211003..4211348 32..377 100 <- Minus

BS20107.pep Sequence

Translation from 16 to 378

> BS20107.pep
MALIKITLICCALIAAIECALLPAAVPVGVPLNTEVDPHPQYAFAYNVQD
ALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQR
GPVPVAARPLVAPVAAPILG*

BS20107.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-PA 120 CG15007-PA 1..120 1..120 611 100 Plus
Ccp84Ad-PA 199 CG2341-PA 45..140 25..118 302 64.6 Plus
Cpr64Ad-PB 247 CG1259-PB 126..218 23..116 299 67.4 Plus
Ccp84Ag-PA 191 CG2342-PA 4..118 5..117 297 55.2 Plus
Cpr5C-PA 145 CG4052-PA 43..137 21..115 294 63.2 Plus