BS20134.complete Sequence
269 bp assembled on 2011-01-07
GenBank Submission: KX803703
> BS20134.complete
GAAGTTATCAGTCGACATGAAGCTGCTGATTCTTCTTTTTGTTTTCATCG
CTCTTGCAAGCAATTCTTTGGCTCTGAAAAATGAAATCTGTGGATTACCC
GCTGCCGCTAATGGTAATTGCTTGGCATTGTTTTCTCGCTGGTCTTATGA
TGCTCAATATAACGTATGCTTTAATTTTATCTACGGCGGATGTCAGGGCA
ACGAAAATTCATTTGAATCCCAGGAAGAGTGTATAAATAAGTGCGTGGAG
TAAAAGCTTTCTAGACCAT
BS20134.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:43:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-RC | 237 | CG31779-PC | 1..237 | 17..253 | 1185 | 100 | Plus |
| Acp24A4-RB | 237 | CG31779-PB | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:43:45
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-RC | 653 | CG31779-RC | 41..282 | 12..253 | 1195 | 99.6 | Plus |
| Acp24A4-RB | 342 | CG31779-RB | 25..266 | 12..253 | 1195 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:43:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 3693555..3693725 | 253..83 | 855 | 100 | Minus |
| 2L | 23513712 | 2L | 3693794..3693865 | 83..12 | 345 | 98.6 | Minus |
| 2L | 23513712 | 2L | 3694098..3694275 | 260..83 | 305 | 78.1 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:43:43 has no hits.
BS20134.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:31:06 Download gff for
BS20134.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..264 | 17..251 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:41:42 Download gff for
BS20134.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..264 | 17..251 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:47:52 Download gff for
BS20134.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..264 | 17..251 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:47:52 Download gff for
BS20134.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 3693557..3693724 | 84..251 | 100 | <- | Minus |
| 2L | 3693794..3693860 | 17..83 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:41:42 Download gff for
BS20134.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 3693557..3693724 | 84..251 | 100 | <- | Minus |
| arm_2L | 3693794..3693860 | 17..83 | 100 | | Minus |
BS20134.pep Sequence
Translation from 16 to 252
> BS20134.pep
MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNV
CFNFIYGGCQGNENSFESQEECINKCVE*
BS20134.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:56:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-PC | 78 | CG31779-PC | 1..78 | 1..78 | 417 | 100 | Plus |
| Acp24A4-PB | 78 | CG31779-PB | 1..78 | 1..78 | 417 | 100 | Plus |
| CG16713-PA | 82 | CG16713-PA | 1..82 | 1..78 | 245 | 57.3 | Plus |
| CG16712-PB | 82 | CG16712-PB | 1..82 | 1..78 | 184 | 46.3 | Plus |
| CG16712-PA | 82 | CG16712-PA | 1..82 | 1..78 | 184 | 46.3 | Plus |
