Clone BS20137 Report

Search the DGRC for BS20137

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG4537-RB
Protein status:BS20137.pep: gold
Sequenced Size:326

Clone Sequence Records

BS20137.complete Sequence

326 bp assembled on 2011-01-07

GenBank Submission: KX802858

> BS20137.complete
GAAGTTATCAGTCGACATGGTTTGCGAGAAGTGCGAGGCCAAGCTCTCCA
AAGTTTCAGCGCCCAATCCCTGGCGAACGAGCACAGCTCCTGCGGGAGGA
CGTAAAATCAACGAGAACAAGGCTTTATCCTCGGCCCGCGAGCGATACAA
TCCCATAGGGACTGCTTTACCACCTTGCCGAATCTGCCGACAGAAAGTGC
ACCAGATGGGTTCGCACTATTGCCAGGCGTGCGCCTACAAAAAGGCCATA
TGCGCCATGTGCGGCAAGAAGATCATGAACACCAAGAACTACAAGCAGAG
CTCAACGTGAAAGCTTTCTAGACCAT

BS20137.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-RB 294 CG4537-PB 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-RB 393 CG4537-RB 26..319 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9890910..9891073 17..180 820 100 Plus
2L 23513712 2L 9891132..9891262 180..310 655 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:39:50 has no hits.

BS20137.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:30:36 Download gff for BS20137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..318 17..309 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:58 Download gff for BS20137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..318 17..309 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:46:30 Download gff for BS20137.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..318 17..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:46:30 Download gff for BS20137.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890910..9891073 17..180 100 -> Plus
2L 9891133..9891261 181..309 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:58 Download gff for BS20137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9890910..9891073 17..180 100 -> Plus
arm_2L 9891133..9891261 181..309 100   Plus

BS20137.pep Sequence

Translation from 16 to 309

> BS20137.pep
MVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARERYNPIGTA
LPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSST*

BS20137.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-PB 97 CG4537-PB 1..97 1..97 530 100 Plus