BS20138.complete Sequence
383 bp assembled on 2011-01-07
GenBank Submission: KX801978
> BS20138.complete
GAAGTTATCAGTCGACATGCGTTTGACAATCTTATGTATTTTTTGCCTGG
CAACTGTGATCCTGGCTATCGACATGGACTCGGATTCACTACAGGAACAG
TACGAAAGGGAGCAGTACAATATTCGCAAAAAAATTTGCCTTCAAAGTTC
GGAATACGGAAAGTGCAAAGGTCGTCGGAAACTTTGGTTCTACAACCCCA
AGAAATCCAAGTGTCAAGTTTTTATCTACTCGAATTGTGGTGGCAATGGC
AACCTTTTCTATACCAAGGAAAGTTGCGTGGAATTTTGTGGCAAATACGA
CTGGAAGAAGGTGCGAAAGACAGGACTTCGACGTTCAGCTGATTATAGAA
GAAAAGATGGGAATTAAAAGCTTTCTAGACCAT
BS20138.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:40:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42827-RD | 351 | CG42827-PD | 1..351 | 17..367 | 1755 | 100 | Plus |
| CG42827-RC | 351 | CG42827-PC | 1..351 | 17..367 | 1755 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:40:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42827-RD | 425 | CG42827-RD | 11..361 | 17..367 | 1755 | 100 | Plus |
| CG42827-RC | 558 | CG42827-RC | 144..494 | 17..367 | 1755 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:40:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 23373301..23373536 | 132..367 | 1180 | 100 | Plus |
| 3R | 32079331 | 3R | 23373120..23373234 | 17..131 | 575 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:40:06 has no hits.
BS20138.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:30:37 Download gff for
BS20138.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42827-RC | 144..492 | 17..365 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:59 Download gff for
BS20138.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42827-RC | 144..492 | 17..365 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:46:34 Download gff for
BS20138.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42827-RC | 144..492 | 17..365 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:46:34 Download gff for
BS20138.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 23373120..23373234 | 17..131 | 100 | -> | Plus |
| 3R | 23373301..23373534 | 132..365 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:59 Download gff for
BS20138.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 19199023..19199256 | 132..365 | 100 | | Plus |
| arm_3R | 19198842..19198956 | 17..131 | 100 | -> | Plus |
BS20138.pep Sequence
Translation from 16 to 366
> BS20138.pep
MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC
KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR
KTGLRRSADYRRKDGN*
BS20138.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:56:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42827-PD | 116 | CG42827-PD | 1..116 | 1..116 | 636 | 100 | Plus |
| CG42827-PC | 116 | CG6784-PB | 1..116 | 1..116 | 636 | 100 | Plus |
| CG42828-PB | 89 | CG42828-PB | 24..78 | 37..91 | 166 | 49.1 | Plus |
| Ppn-PF | 2776 | CG33103-PF | 2193..2247 | 40..94 | 148 | 40 | Plus |
| Ppn-PG | 2841 | CG33103-PG | 2136..2190 | 40..94 | 148 | 40 | Plus |
