Clone BS20148 Report

Search the DGRC for BS20148

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG15023-RB
Protein status:BS20148.pep: gold
Sequenced Size:542

Clone Sequence Records

BS20148.complete Sequence

542 bp assembled on 2011-01-07

GenBank Submission: KX804215

> BS20148.complete
GAAGTTATCAGTCGACATGAAGCTATTCATTTTGGCTACCTGTCTGCTGG
CTTTTGCAGCCGGTGATGTTTCGCATTTGCCGCTGGAACTCCTGGAGGAG
CATCATGAGCATGGCTATGGCTATGACTACCCCAAGCCGGAGATACCATT
TGTGATTACCTCGACGACGGAGCCACCACCGCCACCACCGACTTATCTGC
CACCCAAACCAGTACCCACTTACCTACCTCCTCCTCCGCCCACAACCACA
ACTACCACCACAACCACTCCGGCTCCTACTCCCGCTCCTACCTACCTTCC
TCCCCCTCCACCTACTACCACTACCACGACAACCACTCCCGCTCCCACTC
CTGCTCCCACTTACCTTCCTCCCCCACCTCCACCACCGCGTACCACTACC
ACCACCACCACTACAACCACAACGACACCTGCACCCACGCCAGTGCCCAC
GTACCTTCCACCCCCACCACCACAACCGGAACCGGGTTACCACTACGATG
TGCCCGCCCAAGAGTTCACCTTCTGAAAGCTTTCTAGACCAT

BS20148.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-RD 510 CG15023-PD 1..510 17..526 2550 100 Plus
CG15023-RB 510 CG15023-PB 1..510 17..526 2550 100 Plus
CG15023-RC 507 CG15023-PC 3..507 22..526 2525 100 Plus
CG15023-RD 510 CG15023-PD 213..290 298..375 195 83.3 Plus
CG15023-RB 510 CG15023-PB 213..290 298..375 195 83.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-RD 819 CG15023-RD 186..695 17..526 2550 100 Plus
CG15023-RB 686 CG15023-RB 53..562 17..526 2550 100 Plus
CG15023-RC 683 CG15023-RC 55..559 22..526 2525 100 Plus
CG15023-RD 819 CG15023-RD 398..475 298..375 195 83.3 Plus
CG15023-RB 686 CG15023-RB 265..342 298..375 195 83.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4460746..4461253 526..19 2540 100 Minus
3L 28110227 3L 4460966..4461043 375..298 195 83.3 Minus
Blast to na_te.dros performed on 2014-11-26 15:39:40 has no hits.

BS20148.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:30:34 Download gff for BS20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 21..529 17..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:56 Download gff for BS20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 53..561 17..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:46:27 Download gff for BS20148.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 53..561 17..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:46:27 Download gff for BS20148.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4460747..4461254 17..525 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:56 Download gff for BS20148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4460747..4461254 17..525 99   Minus

BS20148.pep Sequence

Translation from 16 to 525

> BS20148.pep
MKLFILATCLLAFAAGDVSHLPLELLEEHHEHGYGYDYPKPEIPFVITST
TEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPT
TTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPP
PPQPEPGYHYDVPAQEFTF*

BS20148.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-PD 169 CG15023-PD 1..169 1..169 965 100 Plus
CG15023-PB 169 CG15023-PB 1..169 1..169 965 100 Plus
CG15023-PC 168 CG15023-PC 2..168 3..169 955 100 Plus
CG11345-PA 242 CG11345-PA 1..186 1..166 295 39.2 Plus
CG15021-PA 420 CG15021-PA 7..196 5..165 268 34 Plus