Clone BS20150 Report

Search the DGRC for BS20150

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG30051-RC
Protein status:BS20150.pep: gold
Sequenced Size:488

Clone Sequence Records

BS20150.complete Sequence

488 bp assembled on 2011-01-07

GenBank Submission: KX803484

> BS20150.complete
GAAGTTATCAGTCGACATGCACCCAGGGCAAATTGAGGTCAACGAGATCA
ATGGCTATTGGACATTTCTGCTGAGCATCGATTGGAAGGATCCCTGGCTT
ATTGGCCTTATTTTGGCGCATATCTTAACCACCACCACTGCGCTGCTCAG
CCGGAACAGCTCCAACTTCCAGGTTTTCCTCTTCCTAGTACTGTTGCTGG
CAGTCTACTTCACCGAAAGCATCAATGAGTTCGCTGCTAACAACTGGAGT
TCCTTTTCCAGACAACAATACTTCGATAGCAACGGCCTGTTTATCTCGAC
AGTTTTCTCAATACCTATTTTGCTTAATTGCATGCTTTTGATTGGCACTT
GGCTCTACAACTCCACGCAGCTGATGGTGACTCTAAAAACAGCGCAGCTC
AAGGAGCGAGCTCGCAAGGAACGCCAGACTAAGGCGGATTCGGAATCCAT
AGCACATAAAAAGGCAGAGTAGAAGCTTTCTAGACCAT

BS20150.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-RC 456 CG30051-PC 1..456 17..472 2280 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-RC 676 CG30051-RC 78..535 17..474 2290 100 Plus
DUBAI-RB 4024 CG8830-RB 1..64 258..195 320 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12436514..12436663 195..344 750 100 Plus
2R 25286936 2R 12436719..12436849 344..474 655 100 Plus
2R 25286936 2R 12436321..12436438 77..194 590 100 Plus
2R 25286936 2R 12436197..12436256 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:45:22 has no hits.

BS20150.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:31:19 Download gff for BS20150.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 101..556 17..472 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:03 Download gff for BS20150.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 78..533 17..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:48:26 Download gff for BS20150.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 78..533 17..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:48:26 Download gff for BS20150.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12436197..12436256 17..76 100 -> Plus
2R 12436321..12436438 77..194 100 -> Plus
2R 12436514..12436662 195..343 100 -> Plus
2R 12436719..12436847 344..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:03 Download gff for BS20150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8323702..8323761 17..76 100 -> Plus
arm_2R 8323826..8323943 77..194 100 -> Plus
arm_2R 8324019..8324167 195..343 100 -> Plus
arm_2R 8324224..8324352 344..472 100   Plus

BS20150.pep Sequence

Translation from 16 to 471

> BS20150.pep
MHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTTALLSRNSSN
FQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGLFISTVFSIP
ILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKADSESIAHKKA
E*

BS20150.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-PC 151 CG30051-PC 1..151 1..151 777 100 Plus