Clone BS20155 Report

Search the DGRC for BS20155

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG18193-RA
Protein status:BS20155.pep: full length peptide match
Sequenced Size:353

Clone Sequence Records

BS20155.complete Sequence

353 bp assembled on 2011-01-07

GenBank Submission: KX800154

> BS20155.complete
GAAGTTATCAGTCGACATGCAAAGAAACTGTTTCTCTTTGCGCCCCTTCC
TTCGGGGAGTCGGTGATGTGGGTGCAGTTTGTAAGCCCATTCGTGAATTT
CGCAACTCGGCTGCTTTGAAATATGCTGCTGCTGCAGCTGCAGCTCCGAA
GACACGTCCTGGAAAAGTTCCTCCAAAAATGGTCAAATTGAGGAAGCAAT
TTCAGGCGGACAATGATTTGCCGATTTTTCTAAAAGGCGGCAGTATGGAT
AACATATTATACAGACTCACCTGGGTGCTCTGCTTCCTCGGCATAGGTGG
CGATGTATGGTTGTGGCTTGGCTATATCATTGCCTAAAAGCTTTCTAGAC
CAT

BS20155.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18193-RA 321 CG18193-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG18193-RA 587 CG18193-RA 105..427 17..339 1615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8343855..8344150 44..339 1480 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:45:47 has no hits.

BS20155.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:31:23 Download gff for BS20155.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 94..412 17..335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:10 Download gff for BS20155.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 105..423 17..335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:48:35 Download gff for BS20155.complete
Subject Subject Range Query Range Percent Splice Strand
CG18193-RA 105..423 17..335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:48:35 Download gff for BS20155.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8343773..8343799 17..43 100 -> Plus
3R 8343855..8344146 44..335 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:10 Download gff for BS20155.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4169495..4169521 17..43 100 -> Plus
arm_3R 4169577..4169868 44..335 100   Plus

BS20155.pep Sequence

Translation from 16 to 336

> BS20155.pep
MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGK
VPPKMVKLRKQFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLW
LGYIIA*

BS20155.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG18193-PA 106 CG18193-PA 1..106 1..106 565 100 Plus