BS20164.complete Sequence
380 bp assembled on 2011-01-07
GenBank Submission: KX801905
> BS20164.complete
GAAGTTATCAGTCGACATGGTCAAGAAGACATCCGCCAGCCTGGGAAAGA
GCATCTTGCTGGGAGTTCTGTTGTTTCTCGCCGTACACGCACTTCTCACC
GAGGCGGCCCCCTTCCAGGAGCTGGAGCCTCGCAAAGGTCATGTGCCCGT
CTACATCCGACATGGCGATGAGCCACTCAGCGAAATCCATCCAGGACTGG
CCGAGGCCTTCAAGGAGGGCGAATCGAAGAGTCTCGTCACCGAATCTCCC
CAGGCGGAAACTACAAACCCACCAACCACATCCGATGCTCCCGCTCCCGC
TCCGTCCAGCTCCACGGTATCGGATATAGCCAGCTTTGAGGCCATCAAAG
GAAAGACGGATTAAAAGCTTTCTAGACCAT
BS20164.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:47:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14984-RC | 348 | CG14984-PC | 1..348 | 17..364 | 1740 | 100 | Plus |
| CG14984-RB | 348 | CG14984-PB | 1..348 | 17..364 | 1740 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:47:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14984-RC | 709 | CG14984-RC | 202..550 | 16..364 | 1745 | 100 | Plus |
| CG14984-RB | 579 | CG14984-RB | 72..420 | 16..364 | 1745 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:47:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 3951352..3951492 | 364..224 | 690 | 99.3 | Minus |
| 3L | 28110227 | 3L | 3951752..3951877 | 229..104 | 630 | 100 | Minus |
| 3L | 28110227 | 3L | 3952261..3952349 | 104..16 | 445 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:47:03 has no hits.
BS20164.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:31:34 Download gff for
BS20164.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14984-RB | 73..418 | 17..362 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:29 Download gff for
BS20164.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14984-RB | 73..418 | 17..362 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:49:04 Download gff for
BS20164.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14984-RB | 73..418 | 17..362 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:49:04 Download gff for
BS20164.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 3951354..3951486 | 230..362 | 100 | <- | Minus |
| 3L | 3951752..3951876 | 105..229 | 100 | <- | Minus |
| 3L | 3952261..3952348 | 17..104 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:29 Download gff for
BS20164.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 3951354..3951486 | 230..362 | 100 | <- | Minus |
| arm_3L | 3951752..3951876 | 105..229 | 100 | <- | Minus |
| arm_3L | 3952261..3952348 | 17..104 | 100 | | Minus |
BS20164.pep Sequence
Translation from 16 to 363
> BS20164.pep
MVKKTSASLGKSILLGVLLFLAVHALLTEAAPFQELEPRKGHVPVYIRHG
DEPLSEIHPGLAEAFKEGESKSLVTESPQAETTNPPTTSDAPAPAPSSST
VSDIASFEAIKGKTD*
BS20164.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:57:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14984-PC | 115 | CG14984-PC | 1..115 | 1..115 | 577 | 100 | Plus |
| CG14984-PB | 115 | CG14984-PB | 1..115 | 1..115 | 577 | 100 | Plus |
