Clone BS20181 Report

Search the DGRC for BS20181

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:201
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG34107-RA
Protein status:BS20181.pep: gold
Sequenced Size:377

Clone Sequence Records

BS20181.complete Sequence

377 bp assembled on 2011-01-07

GenBank Submission: KX806448

> BS20181.complete
GAAGTTATCAGTCGACATGTGCGAACAGTACTGTGACAAGTTTGAGACCT
TCAATCCGGAGGTTGAGTTTGCCAAGTTTCAAAAACGCAAGCCTGTCGTA
AGGACTGCCCAACTCTATGAGAATTTGCACAAGCGGGAGGATATCAAGTG
TCCCTACAGCTTCAAAGGTTATGGCGTGGAGACGGATTCCAATACAATGT
ACCGCACTTGCAACTCCGAATATGGTTACTATGCACCCAATGCCTATACC
ATACCCAAGCGTTTCTATCCATTGCCCCAGAGTTTCTCCAATGAAGTCGT
GCGTTTCGGCATGTATCGCAATTTCTCCCTGAACACACATATGGATCGTA
CCTTCTATTAGAAGCTTTCTAGACCAT

BS20181.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-RA 345 CG34107-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-RA 611 CG34107-RA 58..402 17..361 1725 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10225173..10225378 156..361 1030 100 Plus
3R 32079331 3R 10224966..10225104 17..155 695 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:48:37 has no hits.

BS20181.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:31:48 Download gff for BS20181.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..402 17..361 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:42:56 Download gff for BS20181.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..402 17..361 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:49:35 Download gff for BS20181.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..402 17..361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:49:35 Download gff for BS20181.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10224966..10225104 17..155 100 -> Plus
3R 10225173..10225378 156..361 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:42:56 Download gff for BS20181.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6050688..6050826 17..155 100 -> Plus
arm_3R 6050895..6051100 156..361 100   Plus

BS20181.pep Sequence

Translation from 16 to 360

> BS20181.pep
MCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQLYENLHKREDIKCPYSFK
GYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRFYPLPQSFSNEVVRFGMY
RNFSLNTHMDRTFY*

BS20181.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-PA 114 CG34107-PA 1..114 1..114 634 100 Plus