Clone BS20225 Report

Search the DGRC for BS20225

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:202
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG14104-RB
Protein status:BS20225.pep: gold
Sequenced Size:239

Clone Sequence Records

BS20225.complete Sequence

239 bp assembled on 2011-01-07

GenBank Submission: KX805668

> BS20225.complete
GAAGTTATCAGTCGACATGAAAGAAAATAAGAAAAAGTCGCGCAAAACGG
CCAATAAGACAAATGAAACGTCAGAGGGTCAGAAAAAGAAGATCATTGAA
CTGCTGCACGAGTACAACGACCTAAAGGATGCCACCCAGCGCGTCCTGGA
AGCCTTGGCCAACCTAAAATGCGTACCCGTCGGATCGGTTTACGCTACAT
ACAACCTGCCCCGCGACGAATAAAAGCTTTCTAGACCAT

BS20225.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-RB 207 CG14104-PB 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-RB 389 CG14104-RB 52..261 15..224 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19806939..19807148 224..15 1050 100 Minus
Blast to na_te.dros performed 2014-11-26 15:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 3344..3373 101..73 102 86.7 Minus

BS20225.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:32:00 Download gff for BS20225.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 51..255 17..221 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:20 Download gff for BS20225.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 54..258 17..221 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:50:11 Download gff for BS20225.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 54..258 17..221 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:50:11 Download gff for BS20225.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806942..19807146 17..221 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:20 Download gff for BS20225.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19800042..19800246 17..221 100   Minus

BS20225.pep Sequence

Translation from 16 to 222

> BS20225.pep
MKENKKKSRKTANKTNETSEGQKKKIIELLHEYNDLKDATQRVLEALANL
KCVPVGSVYATYNLPRDE*

BS20225.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-PB 68 CG14104-PB 1..68 1..68 347 100 Plus