Clone BS20320 Report

Search the DGRC for BS20320

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCG31710-RA
Protein status:BS20320.pep: full length peptide match
Sequenced Size:401

Clone Sequence Records

BS20320.complete Sequence

401 bp assembled on 2011-01-07

GenBank Submission: KX805792

> BS20320.complete
GAAGTTATCAGTCGACATGCTCACCAGACAACCCGACTACACCATCTCCG
AGCTGGGCCATCCCATCCATCAGTGGTCGGATTCGACCGCGTGCGAGTCC
CTCAAGAAGCTGGACTACACAAAGATGCCCAGTTCTCCGCCATCACCACA
TCGCCTGCTGCCACTGAGGGAAACGTTGGACGATTGTTTCAAGCGCTTGA
CGATGAGGAGCAGAGAAGATTTCGAAGAGGATCCCGTATACCAGCAGAAA
TTGAGAAAGAATCAGTGCAATGAACAGCAGCGAAGGCGCAATCAAAAATG
TCGAGATAAAGCCCAGTCCGGAGCAACAACGACGACGACGACGACGACAA
CGATAGCGGCGAGCTGCGATTTAAACAATTTCTGAAAGCTTTCTAGACCA
T

BS20320.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710-RC 369 CG31710-PC 1..369 17..385 1845 100 Plus
CG31710-RA 369 CG31710-PA 1..369 17..385 1845 100 Plus
CG31710-RD 372 CG31710-PD 1..372 17..385 1780 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710-RC 795 CG31710-RC 309..677 17..385 1845 100 Plus
CG31710-RA 728 CG31710-RA 242..610 17..385 1845 100 Plus
CG31710-RD 1253 CG31710-RD 242..613 17..385 1780 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9703268..9703539 288..17 1360 100 Minus
2L 23513712 2L 9703082..9703179 385..288 490 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:30:08 has no hits.

BS20320.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:57 Download gff for BS20320.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 232..599 17..384 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:43 Download gff for BS20320.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 242..609 17..384 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:42:47 Download gff for BS20320.complete
Subject Subject Range Query Range Percent Splice Strand
CG31710-RA 242..609 17..384 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:42:47 Download gff for BS20320.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9703083..9703178 289..384 100 <- Minus
2L 9703268..9703539 17..288 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:43 Download gff for BS20320.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9703083..9703178 289..384 100 <- Minus
arm_2L 9703268..9703539 17..288 100   Minus

BS20320.pep Sequence

Translation from 16 to 384

> BS20320.pep
MLTRQPDYTISELGHPIHQWSDSTACESLKKLDYTKMPSSPPSPHRLLPL
RETLDDCFKRLTMRSREDFEEDPVYQQKLRKNQCNEQQRRRNQKCRDKAQ
SGATTTTTTTTTIAASCDLNNF*

BS20320.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG31710-PC 122 CG31710-PC 1..122 1..122 656 100 Plus
CG31710-PA 122 CG31710-PA 1..122 1..122 656 100 Plus
CG31710-PD 123 CG31710-PD 1..123 1..122 644 99.2 Plus