Clone BS20325 Report

Search the DGRC for BS20325

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptSkadu-RA
Protein status:BS20325.pep: full length peptide match
Sequenced Size:434

Clone Sequence Records

BS20325.complete Sequence

434 bp assembled on 2011-01-07

GenBank Submission: KX804507

> BS20325.complete
GAAGTTATCAGTCGACATGGAATCAGCCGTACGAAAGCGCAGAGTTCCCT
TTCTCCAGGACAATAGACATTCCGATAAACGGACATGCAACTTGTCAACA
ATATCACCTCGCAGCACTCTAGTTCAAACAGTAAAGAAACCCGTCAAGAA
GTTCTCTTCGGATTTAGCCAATCTTCCACCGGTTCCCGCAATCGATGCTT
TTGAGCGAGGCTACCAAGTGGAATCGATATTGGACATGGTACAAAACATC
CACAAGGAGCAATTCCTCTACATAAAGTTTACGAATCTCATTGAACCCGA
GTTGGTTCCTTTGGAACTGGCCTTACAGCATGTTCCACACCTGCTTTCTG
ATTTCTACAAGGAATACGTCCAGGCCTGGCAGAAAATGGAACAACAGAAG
TATGATGAATCTCCTTAAAAGCTTTCTAGACCAT

BS20325.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-RA 402 CG42448-PA 1..402 17..418 2010 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-RA 670 CG42448-RA 47..450 17..420 2020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15547668..15548023 65..420 1780 100 Plus
2L 23513712 2L 15547565..15547612 17..64 240 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:30:44 has no hits.

BS20325.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:59 Download gff for BS20325.complete
Subject Subject Range Query Range Percent Splice Strand
CG42448-RA 47..446 17..416 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:50 Download gff for BS20325.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 47..446 17..416 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:00 Download gff for BS20325.complete
Subject Subject Range Query Range Percent Splice Strand
Skadu-RA 47..446 17..416 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:00 Download gff for BS20325.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15547565..15547612 17..64 100 -> Plus
2L 15547668..15548019 65..416 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:50 Download gff for BS20325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15547565..15547612 17..64 100 -> Plus
arm_2L 15547668..15548019 65..416 100   Plus

BS20325.pep Sequence

Translation from 16 to 417

> BS20325.pep
MESAVRKRRVPFLQDNRHSDKRTCNLSTISPRSTLVQTVKKPVKKFSSDL
ANLPPVPAIDAFERGYQVESILDMVQNIHKEQFLYIKFTNLIEPELVPLE
LALQHVPHLLSDFYKEYVQAWQKMEQQKYDESP*

BS20325.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
Skadu-PA 133 CG42448-PA 1..133 1..133 689 100 Plus