BS20326.complete Sequence
266 bp assembled on 2011-01-07
GenBank Submission: KX806316
> BS20326.complete
GAAGTTATCAGTCGACATGTGCAAGTGTCTGGTCGGAAACGTTGCCTGCT
GCTGCTGCAGTTGTGCAATTAGTGTGCTTGTTTCAATCATCAGTGGATTG
CTGGTGGTCGGCATTGTGGTCGGATTGGCCGTCTACTTTCTTGTCTACTA
CGAACCGGAGGATGAGGTTACCAAGTTCACCAATAAATTAGCCGAAAGTG
TACAGTCGGGATATGGCAAAATTAAGGATGTCATAAGCAAATTAAATTGA
AAGCTTTCTAGACCAT
BS20326.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-RC | 234 | CG42394-PC | 1..234 | 17..250 | 1170 | 100 | Plus |
CG42394-RB | 234 | CG42394-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG42394-RD | 234 | CG42394-PD | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-RC | 634 | CG42394-RC | 94..329 | 15..250 | 1180 | 100 | Plus |
CG42394-RB | 503 | CG42394-RB | 23..258 | 15..250 | 1180 | 100 | Plus |
CG42394-RD | 582 | CG42394-RD | 94..329 | 15..250 | 1180 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10851284..10851483 | 51..250 | 1000 | 100 | Plus |
3R | 32079331 | 3R | 10849983..10850019 | 15..51 | 185 | 100 | Plus |
Blast to na_te.dros performed 2014-11-26 15:30:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 825..900 | 83..11 | 103 | 61.8 | Minus |
BS20326.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:59 Download gff for
BS20326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RC | 98..330 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:53 Download gff for
BS20326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RA | 25..257 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:03 Download gff for
BS20326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42394-RD | 96..328 | 17..249 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:03 Download gff for
BS20326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10849985..10850019 | 17..51 | 100 | -> | Plus |
3R | 10851285..10851482 | 52..249 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:53 Download gff for
BS20326.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6675707..6675741 | 17..51 | 100 | -> | Plus |
arm_3R | 6677007..6677204 | 52..249 | 100 | | Plus |
BS20326.pep Sequence
Translation from 16 to 249
> BS20326.pep
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*
BS20326.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:51:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42394-PC | 77 | CG42394-PC | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PB | 77 | CG42394-PB | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PD | 77 | CG42394-PD | 1..77 | 1..77 | 398 | 100 | Plus |
CG42394-PA | 77 | CG42394-PA | 1..77 | 1..77 | 398 | 100 | Plus |
mex1-PC | 83 | CG7936-PC | 5..81 | 1..75 | 149 | 36.4 | Plus |