Clone BS20326 Report

Search the DGRC for BS20326

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG42394-RA
Protein status:BS20326.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS20326.complete Sequence

266 bp assembled on 2011-01-07

GenBank Submission: KX806316

> BS20326.complete
GAAGTTATCAGTCGACATGTGCAAGTGTCTGGTCGGAAACGTTGCCTGCT
GCTGCTGCAGTTGTGCAATTAGTGTGCTTGTTTCAATCATCAGTGGATTG
CTGGTGGTCGGCATTGTGGTCGGATTGGCCGTCTACTTTCTTGTCTACTA
CGAACCGGAGGATGAGGTTACCAAGTTCACCAATAAATTAGCCGAAAGTG
TACAGTCGGGATATGGCAAAATTAAGGATGTCATAAGCAAATTAAATTGA
AAGCTTTCTAGACCAT

BS20326.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-RC 234 CG42394-PC 1..234 17..250 1170 100 Plus
CG42394-RB 234 CG42394-PB 1..234 17..250 1170 100 Plus
CG42394-RD 234 CG42394-PD 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-RC 634 CG42394-RC 94..329 15..250 1180 100 Plus
CG42394-RB 503 CG42394-RB 23..258 15..250 1180 100 Plus
CG42394-RD 582 CG42394-RD 94..329 15..250 1180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10851284..10851483 51..250 1000 100 Plus
3R 32079331 3R 10849983..10850019 15..51 185 100 Plus
Blast to na_te.dros performed 2014-11-26 15:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 825..900 83..11 103 61.8 Minus

BS20326.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:59 Download gff for BS20326.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RC 98..330 17..249 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:53 Download gff for BS20326.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RA 25..257 17..249 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:03 Download gff for BS20326.complete
Subject Subject Range Query Range Percent Splice Strand
CG42394-RD 96..328 17..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:03 Download gff for BS20326.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10849985..10850019 17..51 100 -> Plus
3R 10851285..10851482 52..249 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:53 Download gff for BS20326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6675707..6675741 17..51 100 -> Plus
arm_3R 6677007..6677204 52..249 100   Plus

BS20326.pep Sequence

Translation from 16 to 249

> BS20326.pep
MCKCLVGNVACCCCSCAISVLVSIISGLLVVGIVVGLAVYFLVYYEPEDE
VTKFTNKLAESVQSGYGKIKDVISKLN*

BS20326.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42394-PC 77 CG42394-PC 1..77 1..77 398 100 Plus
CG42394-PB 77 CG42394-PB 1..77 1..77 398 100 Plus
CG42394-PD 77 CG42394-PD 1..77 1..77 398 100 Plus
CG42394-PA 77 CG42394-PA 1..77 1..77 398 100 Plus
mex1-PC 83 CG7936-PC 5..81 1..75 149 36.4 Plus