Clone BS20333 Report

Search the DGRC for BS20333

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptSfp24C1-RA
Protein status:BS20333.pep: gold
Sequenced Size:275

Clone Sequence Records

BS20333.complete Sequence

275 bp assembled on 2011-01-07

GenBank Submission: KX801482

> BS20333.complete
GAAGTTATCAGTCGACATGAGGTCGTTTTGTATATTGGCCTTATTAATAA
CCCTTAAGTTCGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCC
ACATTCATTGGATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGC
TTCCAAAAACGCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATA
ACTTTTTCATGGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATA
TTACCTTGAAAGCTTTCTAGACCAT

BS20333.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:31:38
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-RA 243 CG42466-PA 1..243 17..259 1215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-RA 363 CG42466-RA 27..271 17..261 1225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3700820..3701000 81..261 905 100 Plus
2L 23513712 2L 3700700..3700763 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:31:37 has no hits.

BS20333.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:03 Download gff for BS20333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..268 17..258 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:08 Download gff for BS20333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..268 17..258 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:22 Download gff for BS20333.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24C1-RA 27..268 17..258 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:22 Download gff for BS20333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3700700..3700763 17..80 100 -> Plus
2L 3700820..3700997 81..258 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:08 Download gff for BS20333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3700700..3700763 17..80 100 -> Plus
arm_2L 3700820..3700997 81..258 100   Plus

BS20333.pep Sequence

Translation from 16 to 258

> BS20333.pep
MRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKNAC
RRISGPCAAQDNFFMDKASCETACKKIILP*

BS20333.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24C1-PA 80 CG42466-PA 1..80 1..80 430 100 Plus
CG42467-PA 82 CG42467-PA 1..81 1..78 143 40.7 Plus