BS20333.complete Sequence
275 bp assembled on 2011-01-07
GenBank Submission: KX801482
> BS20333.complete
GAAGTTATCAGTCGACATGAGGTCGTTTTGTATATTGGCCTTATTAATAA
CCCTTAAGTTCGAAATGGGATATGGAAATTCTGTCTGCAATCTTCAGGCC
ACATTCATTGGATGGTGTAAAATGACTATAAGAGGATTTACTTTCGTAGC
TTCCAAAAACGCATGCCGTAGAATTTCTGGACCATGTGCTGCACAGGATA
ACTTTTTCATGGACAAAGCTTCCTGCGAAACAGCATGCAAAAAAATAATA
TTACCTTGAAAGCTTTCTAGACCAT
BS20333.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:31:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-RA | 243 | CG42466-PA | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:31:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-RA | 363 | CG42466-RA | 27..271 | 17..261 | 1225 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:31:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 3700820..3701000 | 81..261 | 905 | 100 | Plus |
2L | 23513712 | 2L | 3700700..3700763 | 17..80 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:31:37 has no hits.
BS20333.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:03 Download gff for
BS20333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..268 | 17..258 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:08 Download gff for
BS20333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..268 | 17..258 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:43:22 Download gff for
BS20333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp24C1-RA | 27..268 | 17..258 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:43:22 Download gff for
BS20333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 3700700..3700763 | 17..80 | 100 | -> | Plus |
2L | 3700820..3700997 | 81..258 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:08 Download gff for
BS20333.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 3700700..3700763 | 17..80 | 100 | -> | Plus |
arm_2L | 3700820..3700997 | 81..258 | 100 | | Plus |
BS20333.pep Sequence
Translation from 16 to 258
> BS20333.pep
MRSFCILALLITLKFEMGYGNSVCNLQATFIGWCKMTIRGFTFVASKNAC
RRISGPCAAQDNFFMDKASCETACKKIILP*
BS20333.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp24C1-PA | 80 | CG42466-PA | 1..80 | 1..80 | 430 | 100 | Plus |
CG42467-PA | 82 | CG42467-PA | 1..81 | 1..78 | 143 | 40.7 | Plus |