Clone BS20334 Report

Search the DGRC for BS20334

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptSfp24Bb-RA
Protein status:BS20334.pep: gold
Sequenced Size:365

Clone Sequence Records

BS20334.complete Sequence

365 bp assembled on 2011-01-07

GenBank Submission: KX802490

> BS20334.complete
GAAGTTATCAGTCGACATGAAATTCGTGATATTGCTATCCTTGATGTGCA
TCGGAATTGGTTATGCCCAACAACAGTCGGAAGTCAAATGCTTCATGGAC
GCCATTCCTGTGGGCGAATGTGGTAGTCGGATTATAGGGTATAGCTATTC
GAGTGTAAGAGCCCGTTGCGTAAACTATGAGACCATAGGTTGCGAGGTCA
TCGGAAATTTCTTCACCGACAGGAAAGTGTGTGAGGCCAAATGCAAACCG
CCGATCAGTTTTAGAAACAATCCATTCAGTTATTATTTCGAAAGAGCTTT
TAACCAGGCCCGCGATACTTTAAGAAGAATATTCAATCTACCTCAGTAAA
AGCTTTCTAGACCAT

BS20334.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-RA 333 CG42462-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-RA 456 CG42462-RA 67..401 17..351 1675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3669316..3669585 351..82 1350 100 Minus
2L 23513712 2L 3669643..3669709 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:30:13 has no hits.

BS20334.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:57 Download gff for BS20334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 67..397 17..347 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:38:45 Download gff for BS20334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 67..397 17..347 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:42:49 Download gff for BS20334.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp24Bb-RA 67..397 17..347 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:42:49 Download gff for BS20334.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3669320..3669583 84..347 100 <- Minus
2L 3669643..3669709 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:38:45 Download gff for BS20334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3669320..3669583 84..347 100 <- Minus
arm_2L 3669643..3669709 17..83 100   Minus

BS20334.pep Sequence

Translation from 16 to 348

> BS20334.pep
MKFVILLSLMCIGIGYAQQQSEVKCFMDAIPVGECGSRIIGYSYSSVRAR
CVNYETIGCEVIGNFFTDRKVCEAKCKPPISFRNNPFSYYFERAFNQARD
TLRRIFNLPQ*

BS20334.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp24Bb-PA 110 CG42462-PA 1..110 1..110 589 100 Plus
CG42463-PB 111 CG42463-PB 13..97 7..97 148 35.2 Plus