Clone BS20352 Report

Search the DGRC for BS20352

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG14406-RA
Protein status:BS20352.pep: gold
Sequenced Size:344

Clone Sequence Records

BS20352.complete Sequence

344 bp assembled on 2011-01-07

GenBank Submission: KX805327

> BS20352.complete
GAAGTTATCAGTCGACATGACGCTCCACAAGCTGCCCGCCAAGTGCATTC
TGCTCGTGGTGTTGCTGCTCCTGCTGGACTCCAGCCTGGCCAGGTCGCAA
CAGTTCTTCGTCGCCGAGGATGTGATAACAGGAACGGCAACTGAAACGGG
AACTGCAGCTGCAAGCAGAACCGTATTTGGTGATGATCAATTGCCCATCA
ACGATCCATCGGATCTAAGTGCTGGTTTAAATTTGGCGCCCGTTGGCAGT
CTGATTGCGGCAGCAGCGAATGCCGTACCCCCTGCCCCTGTTCAATTTAT
TCGCACGGCCATGAACAGCGGGCTCTGAAAGCTTTCTAGACCAT

BS20352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14406-RB 312 CG14406-PB 1..312 17..328 1560 100 Plus
CG14406-RA 312 CG14406-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14406-RB 375 CG14406-RB 27..338 17..328 1560 100 Plus
CG14406-RA 667 CG14406-RA 27..338 17..328 1560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14910624..14910819 212..17 980 100 Minus
X 23542271 X 14910202..14910318 328..212 585 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:33:35 has no hits.

BS20352.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:11 Download gff for BS20352.complete
Subject Subject Range Query Range Percent Splice Strand
CG14406-RA 27..337 17..327 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:34 Download gff for BS20352.complete
Subject Subject Range Query Range Percent Splice Strand
CG14406-RA 27..337 17..327 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:08 Download gff for BS20352.complete
Subject Subject Range Query Range Percent Splice Strand
CG14406-RA 27..337 17..327 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:08 Download gff for BS20352.complete
Subject Subject Range Query Range Percent Splice Strand
X 14910203..14910317 213..327 100 <- Minus
X 14910624..14910819 17..212 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:34 Download gff for BS20352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14804657..14804852 17..212 100   Minus
arm_X 14804236..14804350 213..327 100 <- Minus

BS20352.pep Sequence

Translation from 16 to 327

> BS20352.pep
MTLHKLPAKCILLVVLLLLLDSSLARSQQFFVAEDVITGTATETGTAAAS
RTVFGDDQLPINDPSDLSAGLNLAPVGSLIAAAANAVPPAPVQFIRTAMN
SGL*

BS20352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14406-PB 103 CG14406-PB 1..103 1..103 503 100 Plus
CG14406-PA 103 CG14406-PA 1..103 1..103 503 100 Plus