Clone BS20354 Report

Search the DGRC for BS20354

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG15034-RA
Protein status:BS20354.pep: full length peptide match
Sequenced Size:347

Clone Sequence Records

BS20354.complete Sequence

347 bp assembled on 2011-01-07

GenBank Submission: KX802953

> BS20354.complete
GAAGTTATCAGTCGACATGGCGTTAAAGATGAATCAATACCAGAACCAGG
TCAAGATAAACTACGTGCAACAATATGTGGGTAGGGTGGCTGGTCCCCTA
GTCGAGCCCATTTTCCCCGTGCCGCAAATGTCATCGGCAACCCTACGAGT
CCGTCGAGCTGTCGTCGAATCCTATCGCGGACCCCAAATTGCTCCCGATG
ATGCCATGCTCCCGATGCCGCCCCACAACAAGGCTCAAAATATGTCTGAG
ATTCTGCACGACCTTCAATTCAAGCTGAAAGATTTCAAGCTGTGGAATCA
AGTCATTCGTCTTCTGAAGAAACGGGTCTAGAAGCTTTCTAGACCAT

BS20354.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-RB 315 CG15034-PB 1..315 17..331 1575 100 Plus
CG15034-RA 315 CG15034-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-RB 1248 CG15034-RB 215..530 16..331 1580 100 Plus
CG15034-RA 794 CG15034-RA 215..530 16..331 1580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7346977..7347292 331..16 1580 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:33:39 has no hits.

BS20354.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:11 Download gff for BS20354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 216..530 17..331 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:36 Download gff for BS20354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 216..530 17..331 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:11 Download gff for BS20354.complete
Subject Subject Range Query Range Percent Splice Strand
CG15034-RA 216..530 17..331 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:11 Download gff for BS20354.complete
Subject Subject Range Query Range Percent Splice Strand
X 7346977..7347291 17..331 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:36 Download gff for BS20354.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7241010..7241324 17..331 100   Minus

BS20354.pep Sequence

Translation from 16 to 330

> BS20354.pep
MALKMNQYQNQVKINYVQQYVGRVAGPLVEPIFPVPQMSSATLRVRRAVV
ESYRGPQIAPDDAMLPMPPHNKAQNMSEILHDLQFKLKDFKLWNQVIRLL
KKRV*

BS20354.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15034-PB 104 CG15034-PB 1..104 1..104 537 100 Plus
CG15034-PA 104 CG15034-PA 1..104 1..104 537 100 Plus