BS20360.complete Sequence
500 bp assembled on 2011-01-07
GenBank Submission: KX803794
> BS20360.complete
GAAGTTATCAGTCGACATGTTCAAATTCGTCGCCTTCTTCGCTTGCCTGG
CTGTGGCCGCCGCTGCCCCCGGTCTGATTGCCGAGACCCACTCGATTGTC
CAGCCGGCGATTCTTGCCAAGACTGCCTACGTGGACACCAGCGCCTCCTC
GGCCATCACCCACCAGAGCAACGTGAACCTGGTGCGCAAGGTGCCAGTGG
TCTACTCCGCCCCGGTTGTTCATGCTGCCCCAGTGGTACATGCCGCTCCT
CTGGTCAAGACTGTGATCCCTGCCGCTCCCCTGGTCAAGACTGTGATCCC
TGCCGCTCCCGTCCTTAAGACTGTGGTCTCCTCTGCTCCTCTGGTCCACA
CTGTCGTCCCAGCCGCTCCACTGGTCAAGACCGTCATCCCAGCTGCTCCG
GTTATCAAGACCGTGATCCCAGCTGCCCCTCTGGTTCACACCGTCCACAG
CGCCCCAGTTGTCTACTCCGCCTACCACAAGTGAAAGCTTTCTAGACCAT
BS20360.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-RA | 468 | CG13059-PA | 1..468 | 17..484 | 2340 | 100 | Plus |
CG13059-RA | 468 | CG13059-PA | 225..380 | 271..426 | 285 | 78.8 | Plus |
CG13059-RA | 468 | CG13059-PA | 255..410 | 241..396 | 285 | 78.8 | Plus |
CG13059-RA | 468 | CG13059-PA | 229..339 | 335..445 | 225 | 80.2 | Plus |
CG13059-RA | 468 | CG13059-PA | 319..429 | 245..355 | 225 | 80.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-RA | 572 | CG13059-RA | 60..528 | 17..485 | 2345 | 100 | Plus |
CG13059-RA | 572 | CG13059-RA | 284..439 | 271..426 | 285 | 78.8 | Plus |
CG13059-RA | 572 | CG13059-RA | 314..469 | 241..396 | 285 | 78.8 | Plus |
CG13059-RA | 572 | CG13059-RA | 288..398 | 335..445 | 225 | 80.2 | Plus |
CG13059-RA | 572 | CG13059-RA | 378..488 | 245..355 | 225 | 80.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16323808..16324264 | 29..485 | 2285 | 100 | Plus |
3L | 28110227 | 3L | 16324020..16324175 | 271..426 | 285 | 78.8 | Plus |
3L | 28110227 | 3L | 16324050..16324205 | 241..396 | 285 | 78.8 | Plus |
3L | 28110227 | 3L | 16324024..16324134 | 335..445 | 225 | 80.2 | Plus |
3L | 28110227 | 3L | 16324114..16324224 | 245..355 | 225 | 80.2 | Plus |
Blast to na_te.dros performed 2014-11-26 15:33:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dnet\R1B | 2038 | Dnet\R1B NETR1B 2038bp | 1288..1328 | 269..230 | 121 | 80.5 | Minus |
BS20360.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:09 Download gff for
BS20360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 65..526 | 22..483 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:27 Download gff for
BS20360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 65..526 | 22..483 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:00 Download gff for
BS20360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13059-RA | 65..526 | 22..483 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:00 Download gff for
BS20360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16323803..16324262 | 22..483 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:27 Download gff for
BS20360.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16316903..16317362 | 22..483 | 99 | | Plus |
BS20360.pep Sequence
Translation from 16 to 483
> BS20360.pep
MFKFVAFFACLAVAAAAPGLIAETHSIVQPAILAKTAYVDTSASSAITHQ
SNVNLVRKVPVVYSAPVVHAAPVVHAAPLVKTVIPAAPLVKTVIPAAPVL
KTVVSSAPLVHTVVPAAPLVKTVIPAAPVIKTVIPAAPLVHTVHSAPVVY
SAYHK*
BS20360.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13059-PA | 155 | CG13059-PA | 1..155 | 1..155 | 764 | 100 | Plus |
CG13040-PB | 185 | CG13040-PB | 1..144 | 1..154 | 234 | 39.4 | Plus |
CG13040-PA | 185 | CG13040-PA | 1..144 | 1..154 | 234 | 39.4 | Plus |
CG13060-PA | 131 | CG13060-PA | 1..130 | 1..144 | 221 | 44.5 | Plus |
CG13041-PA | 124 | CG13041-PA | 1..123 | 1..144 | 203 | 45.2 | Plus |