Clone BS20365 Report

Search the DGRC for BS20365

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG17777-RB
Protein status:BS20365.pep: gold
Sequenced Size:365

Clone Sequence Records

BS20365.complete Sequence

365 bp assembled on 2011-01-07

GenBank Submission: KX800206

> BS20365.complete
GAAGTTATCAGTCGACATGAAGTTCTTGTGCGTGTTCGTCATCCTGGCCA
TTTGCTTCATGAGCACCTGGGCAGCAGTTTCGGAGCCTGCTCCTGAAGCT
CTGGAGCCGGAGCCATCCGCCGTGGATGAGAAGAAGACGGAGAAGAGAGG
CATCTACGGGTTCGGCCACGGCTATGGCGGCTACGGCGGATACGGCGGAT
ACGGTGCCTATGGACACGGTCACTACGGCGGCTACGGTGGACTGAGCAGT
CCCTACTACGGCGGCTACGGATACGTCCATGCGGCGCCCTACTACGGCGG
ACACCACGGCTACTATCCGTACCACCATGGCCACTACGGCTTCTACTAGA
AGCTTTCTAGACCAT

BS20365.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-RC 333 CG17777-PC 1..333 17..349 1665 100 Plus
CG17777-RB 333 CG17777-PB 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-RC 680 CG17777-RC 73..407 15..349 1675 100 Plus
CG17777-RB 561 CG17777-RB 73..407 15..349 1675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2187147..2187468 28..349 1610 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:34:26 has no hits.

BS20365.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:16 Download gff for BS20365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..407 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:51 Download gff for BS20365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..407 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:29 Download gff for BS20365.complete
Subject Subject Range Query Range Percent Splice Strand
CG17777-RB 75..407 17..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:29 Download gff for BS20365.complete
Subject Subject Range Query Range Percent Splice Strand
X 2187142..2187468 22..349 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:51 Download gff for BS20365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2081175..2081501 22..349 99   Plus

BS20365.pep Sequence

Translation from 16 to 348

> BS20365.pep
MKFLCVFVILAICFMSTWAAVSEPAPEALEPEPSAVDEKKTEKRGIYGFG
HGYGGYGGYGGYGAYGHGHYGGYGGLSSPYYGGYGYVHAAPYYGGHHGYY
PYHHGHYGFY*

BS20365.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17777-PC 110 CG17777-PC 1..110 1..110 648 100 Plus
CG17777-PB 110 CG17777-PB 1..110 1..110 648 100 Plus
CG13050-PA 143 CG13050-PA 1..123 1..103 160 38.1 Plus
CG9269-PA 146 CG9269-PA 55..119 45..99 158 55.2 Plus
CG17738-PA 110 CG17738-PA 60..105 48..98 147 54.7 Plus