BS20366.complete Sequence
383 bp assembled on 2011-01-07
GenBank Submission: KX805913
> BS20366.complete
GAAGTTATCAGTCGACATGTTCAAATACGCTGTCGTCGTTCTCGCTCTCG
TTGCCTGCGCTGCTGCCAAGCCTGGACTCCTGGGTGCTCCCCTTGCTTAC
ACTGCTCCTCTGGCTTACTCTGCTCCTGCTGCCGTGGTAGCTGCTCCCGC
TCCAGTTGTGACCGCAACCAGTAGCCAGGTCATCGCCAGGAATTACAATG
GAATCGCCGCTGCTCCTGTGATTGCTCCCGTTGCTGCTCCTCTGGCTGCT
CCTGTGGTGGCGAAGTACGCGGCTACTCCTCTGGCTGCACCACTGGCCTA
CTCCTCTCCTTTGGCTTACTCCGCACCACTGAGCTACGCCGCTGCTTCAG
GACCGCTCCTTATCTAAAAGCTTTCTAGACCAT
BS20366.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:34:36
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32214-RC | 351 | CG32214-PC | 1..351 | 17..367 | 1755 | 100 | Plus |
| CG32214-RB | 351 | CG32214-PB | 1..351 | 17..367 | 1755 | 100 | Plus |
| 825-Oak-RB | 390 | CG32208-PB | 1..272 | 17..288 | 1360 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:34:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32214-RC | 756 | CG32214-RC | 54..406 | 16..368 | 1765 | 100 | Plus |
| CG32214-RB | 465 | CG32214-RB | 54..406 | 16..368 | 1765 | 100 | Plus |
| 825-Oak-RB | 514 | CG32208-RB | 51..323 | 16..288 | 1365 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:34:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 19467471..19467810 | 29..368 | 1700 | 100 | Plus |
| 3L | 28110227 | 3L | 19471847..19472106 | 288..29 | 1300 | 100 | Minus |
| 3L | 28110227 | 3L | 19475961..19476220 | 29..288 | 1270 | 99.2 | Plus |
| 3L | 28110227 | 3L | 19472620..19472844 | 39..245 | 700 | 88.4 | Plus |
| 3L | 28110227 | 3L | 19475223..19475447 | 245..39 | 700 | 88.4 | Minus |
| 3L | 28110227 | 3L | 19466728..19466952 | 245..39 | 685 | 88 | Minus |
| 3L | 28110227 | 3L | 19472858..19472994 | 232..368 | 550 | 93.4 | Plus |
| 3L | 28110227 | 3L | 19471728..19471863 | 368..233 | 515 | 91.9 | Minus |
| 3L | 28110227 | 3L | 19476204..19476339 | 233..368 | 515 | 91.9 | Plus |
| 3L | 28110227 | 3L | 19478430..19478568 | 88..226 | 485 | 89.9 | Plus |
| 3L | 28110227 | 3L | 19423906..19424044 | 88..226 | 485 | 89.9 | Plus |
| 3L | 28110227 | 3L | 19486798..19486968 | 368..197 | 420 | 84.3 | Minus |
| 3L | 28110227 | 3L | 19423002..19423298 | 341..54 | 415 | 78.3 | Minus |
| 3L | 28110227 | 3L | 19488102..19488245 | 88..240 | 295 | 81 | Plus |
| 3L | 28110227 | 3L | 19477668..19477760 | 368..276 | 285 | 87.1 | Minus |
| 3L | 28110227 | 3L | 19488045..19488123 | 49..127 | 275 | 89.9 | Plus |
| 3L | 28110227 | 3L | 19424757..19424836 | 141..220 | 265 | 88.8 | Plus |
| 3L | 28110227 | 3L | 19478373..19478428 | 49..104 | 205 | 91.1 | Plus |
| 3L | 28110227 | 3L | 19464433..19464518 | 225..140 | 205 | 82.6 | Minus |
| 3L | 28110227 | 3L | 19423849..19423904 | 49..104 | 190 | 89.3 | Plus |
Blast to na_te.dros performed 2014-11-26 15:34:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2764..2999 | 258..30 | 152 | 57.5 | Minus |
| Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2777..2891 | 159..42 | 151 | 60.2 | Minus |
BS20366.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:17 Download gff for
BS20366.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 825-Oak-RB | 57..325 | 22..290 | 99 | <- | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:53 Download gff for
BS20366.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG32214-RB | 60..403 | 22..365 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:31 Download gff for
BS20366.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG32214-RB | 60..403 | 22..365 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:31 Download gff for
BS20366.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 19467466..19467807 | 22..365 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:53 Download gff for
BS20366.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 19460566..19460907 | 22..365 | 98 | | Plus |
BS20366.pep Sequence
Translation from 16 to 366
> BS20366.pep
MFKYAVVVLALVACAAAKPGLLGAPLAYTAPLAYSAPAAVVAAPAPVVTA
TSSQVIARNYNGIAAAPVIAPVAAPLAAPVVAKYAATPLAAPLAYSSPLA
YSAPLSYAAASGPLLI*
BS20366.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG32214-PC | 116 | CG32214-PC | 1..116 | 1..116 | 562 | 100 | Plus |
| CG32214-PB | 116 | CG32214-PB | 1..116 | 1..116 | 562 | 100 | Plus |
| 825-Oak-PB | 129 | CG32208-PB | 1..129 | 1..116 | 523 | 87.6 | Plus |
| CG32213-PB | 129 | CG32213-PB | 1..129 | 1..116 | 520 | 86.8 | Plus |
| CG12519-PB | 131 | CG12519-PB | 1..131 | 1..116 | 498 | 84 | Plus |
