Clone BS20372 Report

Search the DGRC for BS20372

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:72
Vector:pDNR-Dual
Associated Gene/TranscriptLysD-RA
Protein status:BS20372.pep: gold
Sequenced Size:455

Clone Sequence Records

BS20372.complete Sequence

455 bp assembled on 2011-01-07

GenBank Submission: KX806299

> BS20372.complete
GAAGTTATCAGTCGACATGAAGGCTTTCATCGTTCTGGTTGCCCTGGCCT
GTGCCGCCCCAGCTTTCGGTCGCACCATGGACCGTTGCTCCCTGGCCCGC
GAGATGTCCAACCTGGGCGTTCCTCGTGACCAATTGGCTCGTTGGGCCTG
TATTGCCGAGCACGAGTCCTCCTACCGCACCGGAGTGGTTGGTCCCGAGA
ACTACAACGGCTCCAACGACTACGGAATCTTCCAGATCAACGACTACTAC
TGGTGCGCTCCTCCCAGCGGTCGCTTCTCCTACAACGAATGCGGATTGAG
CTGCAACGCTCTCCTGACCGACGACATCACCCACTCCGTCCGTTGTGCCC
AGAAGGTCCTCAGCCAGCAGGGATGGTCCGCCTGGTCCACCTGGCACTAC
TGCAGCGGATGGTTGCCGTCCATCGATGACTGCTTCTAAAAGCTTTCTAG
ACCAT

BS20372.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-RA 423 CG9118-PA 1..423 17..439 2115 100 Plus
LysB-RB 423 CG1179-PB 1..423 17..439 1875 96.2 Plus
LysB-RA 423 CG1179-PA 1..423 17..439 1875 96.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-RA 480 CG9118-RA 19..443 16..440 2125 100 Plus
LysB-RB 611 CG1179-RB 22..447 15..440 1890 96.2 Plus
LysB-RA 486 CG1179-RA 22..447 15..440 1890 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1210754..1211178 440..16 2125 100 Minus
3L 28110227 3L 1207392..1207817 15..440 1890 96.2 Plus
3L 28110227 3L 1212952..1213375 17..440 1820 95.3 Plus
3L 28110227 3L 1210484..1210726 16..258 1020 94.7 Plus
3L 28110227 3L 1227770..1228195 15..440 920 82.1 Plus
3L 28110227 3L 1218286..1218607 410..89 635 79.8 Minus
3L 28110227 3L 1194874..1195241 435..68 625 78 Minus
Blast to na_te.dros performed on 2014-11-26 15:33:56 has no hits.

BS20372.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:14 Download gff for BS20372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..440 17..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:39:43 Download gff for BS20372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..440 17..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:20 Download gff for BS20372.complete
Subject Subject Range Query Range Percent Splice Strand
LysD-RA 20..440 17..437 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:20 Download gff for BS20372.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1210757..1211177 17..437 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:39:43 Download gff for BS20372.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1210757..1211177 17..437 100   Minus

BS20372.pep Sequence

Translation from 16 to 438

> BS20372.pep
MKAFIVLVALACAAPAFGRTMDRCSLAREMSNLGVPRDQLARWACIAEHE
SSYRTGVVGPENYNGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALL
TDDITHSVRCAQKVLSQQGWSAWSTWHYCSGWLPSIDDCF*

BS20372.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
LysD-PA 140 CG9118-PA 1..140 1..140 786 100 Plus
LysC-PA 140 CG9111-PA 1..140 1..140 777 98.6 Plus
LysB-PB 140 CG1179-PB 1..140 1..140 770 98.6 Plus
LysB-PA 140 CG1179-PA 1..140 1..140 770 98.6 Plus
LysE-PA 140 CG1180-PA 1..140 1..140 755 96.4 Plus