BS20373.complete Sequence
296 bp assembled on 2011-01-07
GenBank Submission: KX804866
> BS20373.complete
GAAGTTATCAGTCGACATGAGCAAAGTAACCTTCAAAATCACGCTAACTT
CGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGTTCCGGAGGGAACTCCC
TTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGTTCAAGGTTCCGGCGGA
GACGAGTGCCATCATCACGGACGATGGAATTGGCATCAGCCCACAGCAGA
CTGCTGGTAATGTGTTCCTAAAGCACGGATCCGAGCTGCGCCTCATACCC
AGAGATCGAGTGGGCCACCAACTAAGCTAGAAGCTTTCTAGACCAT
BS20373.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:35:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-RA | 264 | CG34191-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
CG34191-RB | 264 | CG34191-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:35:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-RA | 647 | CG34191-RA | 304..567 | 17..280 | 1320 | 100 | Plus |
CG34191-RB | 479 | CG34191-RB | 136..399 | 17..280 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:35:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16952238..16952501 | 17..280 | 1320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:35:24 has no hits.
BS20373.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:20 Download gff for
BS20373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RA | 136..399 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:05 Download gff for
BS20373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 136..399 | 17..280 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:53 Download gff for
BS20373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34191-RB | 136..399 | 17..280 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:53 Download gff for
BS20373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16952238..16952501 | 17..280 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:05 Download gff for
BS20373.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12839743..12840006 | 17..280 | 100 | | Plus |
BS20373.pep Sequence
Translation from 16 to 279
> BS20373.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*
BS20373.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34191-PA | 87 | CG34191-PA | 1..87 | 1..87 | 438 | 100 | Plus |
CG34191-PB | 87 | CG34191-PB | 1..87 | 1..87 | 438 | 100 | Plus |