BS20375.complete Sequence
272 bp assembled on 2011-01-07
GenBank Submission: KX802378
> BS20375.complete
GAAGTTATCAGTCGACATGAAGCTTTTTTCCATTGTTTTCTTCATTTTTT
CCATACTTGGCTGTGTTTCAGCTTTGAAAAACCCTGTCTGCGGAGTTAAA
TATCGAGGAGTTGGCCTATGTAAAATGTTAATCACGAAAATAGTTTATAT
ACCCACTGAAAACAAATGCAAAACGGTGCACATTAGTGGATGTTCGGCCG
AAGGAACTTTCTTCAAAAGCATCAAGGAGTGTGAAGCTAAATGCAAGGAA
TATTAAAAGCTTTCTAGACCAT
BS20375.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:35:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42460-RB | 240 | CG42460-PB | 1..240 | 17..256 | 1200 | 100 | Plus |
| CG42460-RA | 240 | CG42460-PA | 1..240 | 17..256 | 1200 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:35:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42460-RB | 553 | CG42460-RB | 99..339 | 17..257 | 1205 | 100 | Plus |
| CG42460-RA | 411 | CG42460-RA | 99..339 | 17..257 | 1205 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:35:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 3388096..3388269 | 257..84 | 870 | 100 | Minus |
| 2L | 23513712 | 2L | 3388332..3388398 | 83..17 | 335 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:35:42 has no hits.
BS20375.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:21 Download gff for
BS20375.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42460-RA | 99..336 | 17..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:08 Download gff for
BS20375.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42460-RA | 99..336 | 17..254 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:58 Download gff for
BS20375.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42460-RA | 99..336 | 17..254 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:58 Download gff for
BS20375.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 3388099..3388269 | 84..254 | 100 | <- | Minus |
| 2L | 3388332..3388398 | 17..83 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:08 Download gff for
BS20375.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 3388099..3388269 | 84..254 | 100 | <- | Minus |
| arm_2L | 3388332..3388398 | 17..83 | 100 | | Minus |
BS20375.pep Sequence
Translation from 16 to 255
> BS20375.pep
MKLFSIVFFIFSILGCVSALKNPVCGVKYRGVGLCKMLITKIVYIPTENK
CKTVHISGCSAEGTFFKSIKECEAKCKEY*
BS20375.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42460-PB | 79 | CG42460-PB | 1..79 | 1..79 | 421 | 100 | Plus |
| CG42460-PA | 79 | CG42460-PA | 1..79 | 1..79 | 421 | 100 | Plus |
| Sfp23F-PA | 78 | CG42459-PA | 1..78 | 1..78 | 212 | 52.6 | Plus |
| Sfp24Bc-PA | 100 | CG42602-PA | 1..76 | 1..76 | 143 | 34.2 | Plus |
| CG16704-PB | 79 | CG16704-PB | 6..78 | 10..77 | 134 | 37 | Plus |
