Clone BS20376 Report

Search the DGRC for BS20376

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptEig71Eb-RA
Protein status:BS20376.pep: gold
Sequenced Size:320

Clone Sequence Records

BS20376.complete Sequence

320 bp assembled on 2011-01-07

GenBank Submission: KX803196

> BS20376.complete
GAAGTTATCAGTCGACATGTCCAAGATTACTCTGTTTATTGCTTTTATTT
GCCTTTTCGTTATCGTTCAGGCCCAAAGTGATAGAGATATTTGTAGACGG
ATTGTCGCCAGATGTGAGTCAAGGGTCGTGAGAAATGGCAGAAACAACGA
TATTTCGAATATTTTCAATGAGAACTGTCGGCGAACACAAAGAAATTGGC
GTGAAATCTCCCGATGCGAACTCGCAAAAGCTAATTGTATATTGACCCTT
GAGCGATGTAACACGTTGTCCTGCGAGAATGTCCGGCGAGCCCTTGCACA
ATAAAAGCTTTCTAGACCAT

BS20376.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-RB 288 CG7355-PB 1..288 17..304 1440 100 Plus
Eig71Eb-RA 288 CG7355-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-RB 425 CG7355-RB 49..338 17..306 1450 100 Plus
Eig71Eb-RA 472 CG7355-RA 49..338 17..306 1450 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15650082..15650283 41..242 1010 100 Plus
3L 28110227 3L 15650344..15650407 243..306 320 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:35:54 has no hits.

BS20376.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:22 Download gff for BS20376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 49..334 17..302 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:10 Download gff for BS20376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 49..334 17..302 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:03 Download gff for BS20376.complete
Subject Subject Range Query Range Percent Splice Strand
Eig71Eb-RA 49..334 17..302 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:03 Download gff for BS20376.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15649984..15650008 17..41 100 -> Plus
3L 15650083..15650283 42..242 100 -> Plus
3L 15650344..15650403 243..302 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:10 Download gff for BS20376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15643084..15643108 17..41 100 -> Plus
arm_3L 15643183..15643383 42..242 100 -> Plus
arm_3L 15643444..15643503 243..302 100   Plus

BS20376.pep Sequence

Translation from 16 to 303

> BS20376.pep
MSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDISNIF
NENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQ*

BS20376.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Eig71Eb-PB 95 CG7355-PB 1..95 1..95 495 100 Plus
Eig71Eb-PA 95 CG7355-PA 1..95 1..95 495 100 Plus
Eig71Ec-PA 173 CG7608-PA 1..96 1..93 241 51 Plus
Eig71Eg-PA 98 CG7336-PA 1..96 1..93 214 42.7 Plus
Eig71Ei-PB 102 CG7327-PB 1..95 1..89 171 35.8 Plus