BS20376.complete Sequence
320 bp assembled on 2011-01-07
GenBank Submission: KX803196
> BS20376.complete
GAAGTTATCAGTCGACATGTCCAAGATTACTCTGTTTATTGCTTTTATTT
GCCTTTTCGTTATCGTTCAGGCCCAAAGTGATAGAGATATTTGTAGACGG
ATTGTCGCCAGATGTGAGTCAAGGGTCGTGAGAAATGGCAGAAACAACGA
TATTTCGAATATTTTCAATGAGAACTGTCGGCGAACACAAAGAAATTGGC
GTGAAATCTCCCGATGCGAACTCGCAAAAGCTAATTGTATATTGACCCTT
GAGCGATGTAACACGTTGTCCTGCGAGAATGTCCGGCGAGCCCTTGCACA
ATAAAAGCTTTCTAGACCAT
BS20376.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:35:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-RB | 288 | CG7355-PB | 1..288 | 17..304 | 1440 | 100 | Plus |
Eig71Eb-RA | 288 | CG7355-PA | 1..288 | 17..304 | 1440 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:35:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-RB | 425 | CG7355-RB | 49..338 | 17..306 | 1450 | 100 | Plus |
Eig71Eb-RA | 472 | CG7355-RA | 49..338 | 17..306 | 1450 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:35:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15650082..15650283 | 41..242 | 1010 | 100 | Plus |
3L | 28110227 | 3L | 15650344..15650407 | 243..306 | 320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:35:54 has no hits.
BS20376.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:22 Download gff for
BS20376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 49..334 | 17..302 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:10 Download gff for
BS20376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 49..334 | 17..302 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:03 Download gff for
BS20376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Eig71Eb-RA | 49..334 | 17..302 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:03 Download gff for
BS20376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15649984..15650008 | 17..41 | 100 | -> | Plus |
3L | 15650083..15650283 | 42..242 | 100 | -> | Plus |
3L | 15650344..15650403 | 243..302 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:10 Download gff for
BS20376.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15643084..15643108 | 17..41 | 100 | -> | Plus |
arm_3L | 15643183..15643383 | 42..242 | 100 | -> | Plus |
arm_3L | 15643444..15643503 | 243..302 | 100 | | Plus |
BS20376.pep Sequence
Translation from 16 to 303
> BS20376.pep
MSKITLFIAFICLFVIVQAQSDRDICRRIVARCESRVVRNGRNNDISNIF
NENCRRTQRNWREISRCELAKANCILTLERCNTLSCENVRRALAQ*
BS20376.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Eig71Eb-PB | 95 | CG7355-PB | 1..95 | 1..95 | 495 | 100 | Plus |
Eig71Eb-PA | 95 | CG7355-PA | 1..95 | 1..95 | 495 | 100 | Plus |
Eig71Ec-PA | 173 | CG7608-PA | 1..96 | 1..93 | 241 | 51 | Plus |
Eig71Eg-PA | 98 | CG7336-PA | 1..96 | 1..93 | 214 | 42.7 | Plus |
Eig71Ei-PB | 102 | CG7327-PB | 1..95 | 1..89 | 171 | 35.8 | Plus |