Clone BS20382 Report

Search the DGRC for BS20382

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG33333-RA
Protein status:BS20382.pep: gold
Sequenced Size:479

Clone Sequence Records

BS20382.complete Sequence

479 bp assembled on 2011-01-07

GenBank Submission: KX806026

> BS20382.complete
GAAGTTATCAGTCGACATGGCAGTCGGCTTCATTGTAATCTTCAGCGCCA
TATTCGTCCTGGCCCAAGGATCAAATCTTTTGCCCATTGAGCAGCAATCG
GAGGTGCCAATCCATTCTGGTGCTCCAGCGGCAGTCATTTCGCAAGGACA
ACAGTCTGTGTCCCAGTCCGTTGGTTCTGCTTACGGTCAAGACCAAGGGT
TGGCTGGTGCACGACCCTATTGGGCTGCACCTCGTCCTGCTCTGGCTGCA
CCTCGTCCTGCTGAGTCCTACGCTCGTCCTGCTGTGGCTGTACCTCGTCC
TTCTGTGGCTGCACCTCGTCCGGCTGTGTCCTACGCTCGTCCTGCAGCCG
TGGTGGTTCCTGCTTTGGTGGTTGCTCCTATTCGCCAGCCTCAGGGAGTC
CCTGTCCCAGCCGTTGTAGGAGCTAGTCAAGGAAATGTGTACCATGGTCG
CCATCATGGCTAAAAGCTTTCTAGACCAT

BS20382.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-RA 447 CG33333-PA 1..447 17..463 2235 100 Plus
CG33333-RA 447 CG33333-PA 207..266 286..345 225 91.7 Plus
CG33333-RA 447 CG33333-PA 270..329 223..282 225 91.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-RA 576 CG33333-RA 18..464 17..463 2235 100 Plus
CG33333-RA 576 CG33333-RA 224..283 286..345 225 91.7 Plus
CG33333-RA 576 CG33333-RA 287..346 223..282 225 91.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17417484..17417930 17..463 2235 100 Plus
3R 32079331 3R 17417690..17417749 286..345 225 91.7 Plus
3R 32079331 3R 17417753..17417812 223..282 225 91.7 Plus
Blast to na_te.dros performed on 2014-11-26 15:35:06 has no hits.

BS20382.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:19 Download gff for BS20382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 18..462 17..461 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:01 Download gff for BS20382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 18..462 17..461 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:44:43 Download gff for BS20382.complete
Subject Subject Range Query Range Percent Splice Strand
CG33333-RA 18..462 17..461 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:44:43 Download gff for BS20382.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17417484..17417928 17..461 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:01 Download gff for BS20382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13243206..13243650 17..461 100   Plus

BS20382.pep Sequence

Translation from 16 to 462

> BS20382.pep
MAVGFIVIFSAIFVLAQGSNLLPIEQQSEVPIHSGAPAAVISQGQQSVSQ
SVGSAYGQDQGLAGARPYWAAPRPALAAPRPAESYARPAVAVPRPSVAAP
RPAVSYARPAAVVVPALVVAPIRQPQGVPVPAVVGASQGNVYHGRHHG*

BS20382.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG33333-PA 148 CG33333-PA 1..148 1..148 750 100 Plus
CG42834-PA 122 CG42834-PA 1..103 1..88 139 36.1 Plus