BS20389.complete Sequence
440 bp assembled on 2011-01-07
GenBank Submission: KX803200
> BS20389.complete
GAAGTTATCAGTCGACATGGGTTTTCACATGGGACGACAGCTGCTACTCT
CCGGATTCCTGCTGGTGATGCTTCAGATGGTGACCCAAACGCAGGCCAGG
CCGCAGGATGTGATCACAGTTGCTGGCGAGGAGACAGAGGTGGTGATCAA
GCGGGAGGGCGATGACGATGGAGACGACGATGACTCCTCCTCCGAGGAAA
CAGTCGAGGATTCCGAGGAAAGCAGACGCAGACGACGCGAGGTGAATACG
GACAACACGCCATCGGCTCGAGCGGTTATTCCAGGCGAGCAAGTAGTCCC
CATTCTCTTGGAGGCCATTCTTCCCAGCGTGGATGCAGCGGGCGATCGCT
TCGCAAGATCTGTGCAATTTCTGAAAAACTTGACCCCTGGCTCTGAATTG
TTTGCCGTCGAGAAGAACGAATAGAAGCTTTCTAGACCAT
BS20389.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:36:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Os-C-RC | 408 | CG3250-PC | 1..408 | 17..424 | 2040 | 100 | Plus |
Os-C-RD | 396 | CG3250-PD | 1..396 | 17..424 | 1825 | 97.1 | Plus |
Os-C-RB | 462 | CG3250-PB | 1..269 | 17..285 | 1345 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:36:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Os-C-RC | 550 | CG3250-RC | 17..424 | 17..424 | 2040 | 100 | Plus |
Os-C-RD | 538 | CG3250-RD | 17..412 | 17..424 | 1825 | 97.1 | Plus |
Os-C-RB | 604 | CG3250-RB | 17..285 | 17..285 | 1345 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:36:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 7979114..7979295 | 104..285 | 910 | 100 | Plus |
3R | 32079331 | 3R | 7979347..7979488 | 283..424 | 710 | 100 | Plus |
3R | 32079331 | 3R | 7978975..7979065 | 17..107 | 455 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:36:48 has no hits.
BS20389.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:25 Download gff for
BS20389.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Os-C-RC | 17..424 | 17..424 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:25 Download gff for
BS20389.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Os-C-RC | 17..424 | 17..424 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:25 Download gff for
BS20389.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Os-C-RC | 17..424 | 17..424 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:25 Download gff for
BS20389.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 7978975..7979064 | 17..106 | 100 | -> | Plus |
3R | 7979117..7979294 | 107..284 | 100 | -> | Plus |
3R | 7979349..7979488 | 285..424 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:25 Download gff for
BS20389.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 3804697..3804786 | 17..106 | 100 | -> | Plus |
arm_3R | 3804839..3805016 | 107..284 | 100 | -> | Plus |
arm_3R | 3805071..3805210 | 285..424 | 100 | | Plus |
BS20389.pep Sequence
Translation from 16 to 423
> BS20389.pep
MGFHMGRQLLLSGFLLVMLQMVTQTQARPQDVITVAGEETEVVIKREGDD
DGDDDDSSSEETVEDSEESRRRRREVNTDNTPSARAVIPGEQVVPILLEA
ILPSVDAAGDRFARSVQFLKNLTPGSELFAVEKNE*
BS20389.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:53:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Os-C-PC | 135 | CG3250-PC | 1..135 | 1..135 | 670 | 100 | Plus |
Os-C-PB | 153 | CG3250-PB | 1..153 | 1..135 | 641 | 88.2 | Plus |
Os-C-PD | 131 | CG3250-PD | 1..131 | 1..135 | 635 | 97 | Plus |