Clone BS20390 Report

Search the DGRC for BS20390

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptSfp23F-RA
Protein status:BS20390.pep: gold
Sequenced Size:269

Clone Sequence Records

BS20390.complete Sequence

269 bp assembled on 2011-01-07

GenBank Submission: KX802929

> BS20390.complete
GAAGTTATCAGTCGACATGCGTTTATATAAAATATTTTGCCTAATTTGTT
CCATATTTGGCTGTGTTTCAGCTTTAAAAGATCCGAGCTGTGCTGTTGAG
TTGTTTGGCCAAGGTGCTTGCAACACTTTGATTACTCGAATCGGCTATTT
ACGTTGGGAAAACATGTGTACATCAAAGAACTTTGTTGCATGCGACACCG
ATGGAACTTCATTTGAGAGCATTAAGGAATGCGAAGATAAATGCAAAGAG
TAGAAGCTTTCTAGACCAT

BS20390.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-RA 237 CG42459-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-RA 322 CG42459-RA 36..272 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3387404..3387573 253..84 850 100 Minus
2L 23513712 2L 3387642..3387708 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:36:58 has no hits.

BS20390.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:26 Download gff for BS20390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..272 17..253 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:27 Download gff for BS20390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..272 17..253 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:30 Download gff for BS20390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp23F-RA 36..272 17..253 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:30 Download gff for BS20390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3387404..3387573 84..253 100 <- Minus
2L 3387642..3387708 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:27 Download gff for BS20390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3387404..3387573 84..253 100 <- Minus
arm_2L 3387642..3387708 17..83 100   Minus

BS20390.pep Sequence

Translation from 16 to 252

> BS20390.pep
MRLYKIFCLICSIFGCVSALKDPSCAVELFGQGACNTLITRIGYLRWENM
CTSKNFVACDTDGTSFESIKECEDKCKE*

BS20390.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp23F-PA 78 CG42459-PA 1..78 1..78 430 100 Plus
CG42460-PB 79 CG42460-PB 1..78 1..78 212 52.6 Plus
CG42460-PA 79 CG42460-PA 1..78 1..78 212 52.6 Plus