Clone BS20393 Report

Search the DGRC for BS20393

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:203
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG34191-RA
Protein status:BS20393.pep: full length peptide match
Sequenced Size:296

Clone Sequence Records

BS20393.complete Sequence

296 bp assembled on 2011-01-07

GenBank Submission: KX802095

> BS20393.complete
GAAGTTATCAGTCGACATGAGCAAAGTAACCTTCAAAATCACGCTAACTT
CGGACCCCAAGCTGCCCTTTAAGGTGCTTAGTGTTCCGGAGGGAACTCCC
TTTACGGCTGTGCTGAAATTCGCCTCTGAAGAGTTCAAGGTTCCGGCGGA
GACGAGTGCCATCATCACGGACGATGGAATTGGCATCAGCCCACAGCAGA
CTGCTGGTAATGTGTTCCTAAAGCACGGATCCGAGCTGCGCCTCATACCC
AGAGATCGAGTGGGCCACCAACTAAGCTAGAAGCTTTCTAGACCAT

BS20393.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-RA 264 CG34191-PA 1..264 17..280 1320 100 Plus
CG34191-RB 264 CG34191-PB 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-RA 647 CG34191-RA 304..567 17..280 1320 100 Plus
CG34191-RB 479 CG34191-RB 136..399 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16952238..16952501 17..280 1320 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:37:19 has no hits.

BS20393.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:09:27 Download gff for BS20393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RA 136..399 17..280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:40:31 Download gff for BS20393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 136..399 17..280 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:45:39 Download gff for BS20393.complete
Subject Subject Range Query Range Percent Splice Strand
CG34191-RB 136..399 17..280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:45:39 Download gff for BS20393.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16952238..16952501 17..280 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:40:31 Download gff for BS20393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12839743..12840006 17..280 100   Plus

BS20393.pep Sequence

Translation from 16 to 279

> BS20393.pep
MSKVTFKITLTSDPKLPFKVLSVPEGTPFTAVLKFASEEFKVPAETSAII
TDDGIGISPQQTAGNVFLKHGSELRLIPRDRVGHQLS*

BS20393.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG34191-PA 87 CG34191-PA 1..87 1..87 438 100 Plus
CG34191-PB 87 CG34191-PB 1..87 1..87 438 100 Plus