BS20438.complete Sequence
236 bp assembled on 2011-01-07
GenBank Submission: KX800638
> BS20438.complete
GAAGTTATCAGTCGACATGCTGGACCCCATTTCGGACGCACCGCTGGTCT
TGGCCTACGTCTTTATGTCGCTGCTGGTGCTCATTGTGTGCTTCATACTG
GTCAATGTGGTCCACAAGCTGTATCGCAGTCTCAACGGCGAGGTATCAAC
GGGGCTGGTTTCTCCGGCACAGCAGCTGAAGACCTCCATCATGGAGCTAG
ACGCCATGAAGACCGGTTAGAAGCTTTCTAGACCAT
BS20438.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:39:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-RB | 204 | CG13255-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
CG13255-RA | 204 | CG13255-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:39:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-RB | 1352 | CG13255-RB | 890..1098 | 12..220 | 1030 | 99.5 | Plus |
CG13255-RA | 940 | CG13255-RA | 478..686 | 12..220 | 1030 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:39:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 20838377..20838585 | 12..220 | 1030 | 99.5 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:39:10 has no hits.
BS20438.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:29 Download gff for
BS20438.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..686 | 17..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:50 Download gff for
BS20438.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..686 | 17..220 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:17:35 Download gff for
BS20438.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13255-RA | 483..686 | 17..220 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:17:35 Download gff for
BS20438.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 20838382..20838585 | 17..220 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:50 Download gff for
BS20438.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 20831482..20831685 | 17..220 | 100 | | Plus |
BS20438.pep Sequence
Translation from 16 to 219
> BS20438.pep
MLDPISDAPLVLAYVFMSLLVLIVCFILVNVVHKLYRSLNGEVSTGLVSP
AQQLKTSIMELDAMKTG*
BS20438.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13255-PB | 67 | CG13255-PB | 1..67 | 1..67 | 327 | 100 | Plus |
CG13255-PA | 67 | CG13255-PA | 1..67 | 1..67 | 327 | 100 | Plus |