Clone BS20438 Report

Search the DGRC for BS20438

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:204
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG13255-RA
Protein status:BS20438.pep: full length peptide match
Sequenced Size:236

Clone Sequence Records

BS20438.complete Sequence

236 bp assembled on 2011-01-07

GenBank Submission: KX800638

> BS20438.complete
GAAGTTATCAGTCGACATGCTGGACCCCATTTCGGACGCACCGCTGGTCT
TGGCCTACGTCTTTATGTCGCTGCTGGTGCTCATTGTGTGCTTCATACTG
GTCAATGTGGTCCACAAGCTGTATCGCAGTCTCAACGGCGAGGTATCAAC
GGGGCTGGTTTCTCCGGCACAGCAGCTGAAGACCTCCATCATGGAGCTAG
ACGCCATGAAGACCGGTTAGAAGCTTTCTAGACCAT

BS20438.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-RB 204 CG13255-PB 1..204 17..220 1020 100 Plus
CG13255-RA 204 CG13255-PA 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-RB 1352 CG13255-RB 890..1098 12..220 1030 99.5 Plus
CG13255-RA 940 CG13255-RA 478..686 12..220 1030 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20838377..20838585 12..220 1030 99.5 Plus
Blast to na_te.dros performed on 2014-11-26 15:39:10 has no hits.

BS20438.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:29 Download gff for BS20438.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..686 17..220 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:50 Download gff for BS20438.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..686 17..220 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:17:35 Download gff for BS20438.complete
Subject Subject Range Query Range Percent Splice Strand
CG13255-RA 483..686 17..220 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:17:35 Download gff for BS20438.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20838382..20838585 17..220 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:50 Download gff for BS20438.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20831482..20831685 17..220 100   Plus

BS20438.pep Sequence

Translation from 16 to 219

> BS20438.pep
MLDPISDAPLVLAYVFMSLLVLIVCFILVNVVHKLYRSLNGEVSTGLVSP
AQQLKTSIMELDAMKTG*

BS20438.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13255-PB 67 CG13255-PB 1..67 1..67 327 100 Plus
CG13255-PA 67 CG13255-PA 1..67 1..67 327 100 Plus