Clone BS20470 Report

Search the DGRC for BS20470

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:204
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG34293-RA
Protein status:BS20470.pep: full length peptide match
Sequenced Size:287

Clone Sequence Records

BS20470.complete Sequence

287 bp assembled on 2011-01-07

GenBank Submission: KX801357

> BS20470.complete
GAAGTTATCAGTCGACATGTTAAATTTAAAACACTTTGCCAGCCACGCCT
ACCGCCAGTACGAACTGGTGACGTGCGTGAACATGCTGGAGCCCTGGGAA
AAGAAGCTGATCAATGGATTCTTTCTGGTGATGCTGCTCCTGGTGCTCTT
CTCCAGCTTCATGTATCTTCCCAACTACATGCAAACCCTAATGCAATTTG
TAACGCCGCCCAACTGGCACAATTCCCCGGATAGCGCAGCCTATGTGGCA
CAAAAGATCGCACGGAGCTGAAAGCTTTCTAGACCAT

BS20470.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-RB 255 CG34293-PB 1..255 17..271 1275 100 Plus
CG34293-RA 255 CG34293-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:19:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-RB 740 CG34293-RB 48..302 17..271 1275 100 Plus
CG34293-RA 446 CG34293-RA 48..302 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27165213..27165370 271..114 790 100 Minus
3R 32079331 3R 27165432..27165528 113..17 485 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:19:24 has no hits.

BS20470.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:08:21 Download gff for BS20470.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..301 22..270 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:42 Download gff for BS20470.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..301 22..270 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:38:53 Download gff for BS20470.complete
Subject Subject Range Query Range Percent Splice Strand
CG34293-RA 53..301 22..270 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:38:53 Download gff for BS20470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27165214..27165370 114..270 100 <- Minus
3R 27165432..27165523 22..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:42 Download gff for BS20470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22991154..22991245 22..113 100   Minus
arm_3R 22990936..22991092 114..270 100 <- Minus

BS20470.pep Sequence

Translation from 16 to 270

> BS20470.pep
MLNLKHFASHAYRQYELVTCVNMLEPWEKKLINGFFLVMLLLVLFSSFMY
LPNYMQTLMQFVTPPNWHNSPDSAAYVAQKIARS*

BS20470.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34293-PB 84 CG34293-PB 1..84 1..84 447 100 Plus
CG34293-PA 84 CG34293-PA 1..84 1..84 447 100 Plus