Clone BS20507 Report

Search the DGRC for BS20507

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:205
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG34330-RA
Protein status:BS20507.pep: gold
Sequenced Size:179

Clone Sequence Records

BS20507.complete Sequence

179 bp assembled on 2011-01-11

GenBank Submission: KX801410

> BS20507.complete
GAAGTTATCAGTCGACATGTGGTCGAAAATTGCCATCGCCGGAGCCCTGC
TCGTGATGGGTGGCGTCCTGTCCTCCAGCGTGGTGGACAACTTCGCCTAC
GTGGATCGCTCGCTGCCGGTGGCCATGCCCAAGGCAAAGGCCTTCCAAGT
GAAGCAGGAGTGAAAGCTTTCTAGACCAT

BS20507.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-RB 147 CG34330-PB 1..147 17..163 720 99.3 Plus
CG34330-RA 147 CG34330-PA 1..147 17..163 720 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-RB 699 CG34330-RB 206..353 16..163 725 99.3 Plus
CG34330-RA 618 CG34330-RA 125..272 16..163 725 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19068621..19068768 163..16 725 99.3 Minus
Blast to na_te.dros performed on 2014-11-26 15:41:21 has no hits.

BS20507.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:32 Download gff for BS20507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..271 17..162 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:21 Download gff for BS20507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..271 17..162 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:16 Download gff for BS20507.complete
Subject Subject Range Query Range Percent Splice Strand
CG34330-RA 126..271 17..162 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:16 Download gff for BS20507.complete
Subject Subject Range Query Range Percent Splice Strand
X 19068622..19068767 17..162 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:21 Download gff for BS20507.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18962655..18962800 17..162 99   Minus

BS20507.pep Sequence

Translation from 16 to 162

> BS20507.pep
MWSKIAIAGALLVMGGVLSSSVVDNFAYVDRSLPVAMPKAKAFQVKQE*

BS20507.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34330-PB 48 CG34330-PB 1..48 1..48 235 100 Plus
CG34330-PA 48 CG34330-PA 1..48 1..48 235 100 Plus