BS20507.complete Sequence
179 bp assembled on 2011-01-11
GenBank Submission: KX801410
> BS20507.complete
GAAGTTATCAGTCGACATGTGGTCGAAAATTGCCATCGCCGGAGCCCTGC
TCGTGATGGGTGGCGTCCTGTCCTCCAGCGTGGTGGACAACTTCGCCTAC
GTGGATCGCTCGCTGCCGGTGGCCATGCCCAAGGCAAAGGCCTTCCAAGT
GAAGCAGGAGTGAAAGCTTTCTAGACCAT
BS20507.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-RB | 147 | CG34330-PB | 1..147 | 17..163 | 720 | 99.3 | Plus |
CG34330-RA | 147 | CG34330-PA | 1..147 | 17..163 | 720 | 99.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-RB | 699 | CG34330-RB | 206..353 | 16..163 | 725 | 99.3 | Plus |
CG34330-RA | 618 | CG34330-RA | 125..272 | 16..163 | 725 | 99.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19068621..19068768 | 163..16 | 725 | 99.3 | Minus |
Blast to na_te.dros performed on 2014-11-26 15:41:21 has no hits.
BS20507.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:32 Download gff for
BS20507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..271 | 17..162 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:21 Download gff for
BS20507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..271 | 17..162 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:16 Download gff for
BS20507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34330-RA | 126..271 | 17..162 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:16 Download gff for
BS20507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19068622..19068767 | 17..162 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:21 Download gff for
BS20507.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 18962655..18962800 | 17..162 | 99 | | Minus |
BS20507.pep Sequence
Translation from 16 to 162
> BS20507.pep
MWSKIAIAGALLVMGGVLSSSVVDNFAYVDRSLPVAMPKAKAFQVKQE*
BS20507.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34330-PB | 48 | CG34330-PB | 1..48 | 1..48 | 235 | 100 | Plus |
CG34330-PA | 48 | CG34330-PA | 1..48 | 1..48 | 235 | 100 | Plus |