BS20508.complete Sequence
227 bp assembled on 2011-01-11
GenBank Submission: KX803441
> BS20508.complete
GAAGTTATCAGTCGACATGAAGTTCACCATCGTTTTCCTGCTGCTTGCTT
GCGTTTTTGCCATGGGTGTGGCCACTCCCGGCAAGCCACGCCCCTACAGC
CCACGCCCCACCTCCCATCCCCGCCCCATTCGGGTGAGGCGCGAGGCACT
GGCCATCGAGGATCACCTGACTCAAGCTGCCATCAGGCCACCACCCATTC
TGCCCGCCTAAAAGCTTTCTAGACCAT
BS20508.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dro-RB | 195 | CG10816-PB | 1..195 | 17..211 | 960 | 99.5 | Plus |
Dro-RA | 195 | CG10816-PA | 1..195 | 17..211 | 960 | 99.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dro-RB | 754 | CG10816-RB | 30..225 | 17..212 | 965 | 99.5 | Plus |
Dro-RA | 355 | CG10816-RA | 30..225 | 17..212 | 965 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14745990..14746185 | 17..212 | 965 | 99.5 | Plus |
Blast to na_te.dros performed 2014-11-26 15:42:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Rt1b | 5171 | Rt1b RT1B 5150bp | 3935..3965 | 46..16 | 101 | 80.6 | Minus |
BS20508.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:33 Download gff for
BS20508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dro-RA | 35..227 | 17..209 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:47 Download gff for
BS20508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dro-RA | 30..222 | 17..209 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:40 Download gff for
BS20508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Dro-RA | 30..222 | 17..209 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:40 Download gff for
BS20508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14745990..14746182 | 17..209 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:47 Download gff for
BS20508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10633495..10633687 | 17..209 | 99 | | Plus |
BS20508.pep Sequence
Translation from 16 to 210
> BS20508.pep
MKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIRVRREALAIEDH
LTQAAIRPPPILPA*
BS20508.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dro-PB | 64 | CG10816-PB | 1..64 | 1..64 | 335 | 100 | Plus |
Dro-PA | 64 | CG10816-PA | 1..64 | 1..64 | 335 | 100 | Plus |