Clone BS20508 Report

Search the DGRC for BS20508

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:205
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptDro-RA
Protein status:BS20508.pep: gold
Sequenced Size:227

Clone Sequence Records

BS20508.complete Sequence

227 bp assembled on 2011-01-11

GenBank Submission: KX803441

> BS20508.complete
GAAGTTATCAGTCGACATGAAGTTCACCATCGTTTTCCTGCTGCTTGCTT
GCGTTTTTGCCATGGGTGTGGCCACTCCCGGCAAGCCACGCCCCTACAGC
CCACGCCCCACCTCCCATCCCCGCCCCATTCGGGTGAGGCGCGAGGCACT
GGCCATCGAGGATCACCTGACTCAAGCTGCCATCAGGCCACCACCCATTC
TGCCCGCCTAAAAGCTTTCTAGACCAT

BS20508.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dro-RB 195 CG10816-PB 1..195 17..211 960 99.5 Plus
Dro-RA 195 CG10816-PA 1..195 17..211 960 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dro-RB 754 CG10816-RB 30..225 17..212 965 99.5 Plus
Dro-RA 355 CG10816-RA 30..225 17..212 965 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14745990..14746185 17..212 965 99.5 Plus
Blast to na_te.dros performed 2014-11-26 15:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1b 5171 Rt1b RT1B 5150bp 3935..3965 46..16 101 80.6 Minus

BS20508.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:33 Download gff for BS20508.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 35..227 17..209 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:47 Download gff for BS20508.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 30..222 17..209 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:40 Download gff for BS20508.complete
Subject Subject Range Query Range Percent Splice Strand
Dro-RA 30..222 17..209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:40 Download gff for BS20508.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14745990..14746182 17..209 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:47 Download gff for BS20508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10633495..10633687 17..209 99   Plus

BS20508.pep Sequence

Translation from 16 to 210

> BS20508.pep
MKFTIVFLLLACVFAMGVATPGKPRPYSPRPTSHPRPIRVRREALAIEDH
LTQAAIRPPPILPA*

BS20508.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dro-PB 64 CG10816-PB 1..64 1..64 335 100 Plus
Dro-PA 64 CG10816-PA 1..64 1..64 335 100 Plus