Clone BS20510 Report

Search the DGRC for BS20510

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:205
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG12158-RA
Protein status:BS20510.pep: gold
Sequenced Size:218

Clone Sequence Records

BS20510.complete Sequence

218 bp assembled on 2011-01-11

GenBank Submission: KX802558

> BS20510.complete
GAAGTTATCAGTCGACATGAAGCAGTTCGCATTGTTCAGCATCTTCCTTC
TAATTCTGGCTGTGGGTTTGGCACAAATGCCGCTGCAGGTGGCCGCCCAG
GGCCAAAATGGACATTCGCAGGGACAGCCGCCAAGACCGCCAAATGGCAA
TGGAAACGGCAACCAGCAGAGTGGACAAGGACAAAGCGGGCAGAACAACT
AGAAGCTTTCTAGACCAT

BS20510.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-RA 186 CG12158-PA 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-RA 279 CG12158-RA 16..205 15..204 950 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9362648..9362782 204..70 675 100 Minus
2R 25286936 2R 9362835..9362891 71..15 285 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:40:43 has no hits.

BS20510.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:30 Download gff for BS20510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..203 17..202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:12 Download gff for BS20510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..203 17..202 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:04 Download gff for BS20510.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 18..203 17..202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:04 Download gff for BS20510.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9362650..9362781 71..202 100 <- Minus
2R 9362836..9362889 17..70 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:12 Download gff for BS20510.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5250155..5250286 71..202 100 <- Minus
arm_2R 5250341..5250394 17..70 100   Minus

BS20510.pep Sequence

Translation from 16 to 201

> BS20510.pep
MKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNGNGNGNQ
QSGQGQSGQNN*

BS20510.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-PA 61 CG12158-PA 1..61 1..61 319 100 Plus