Clone BS20513 Report

Search the DGRC for BS20513

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:205
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG33155-RA
Protein status:BS20513.pep: full length peptide match
Sequenced Size:215

Clone Sequence Records

BS20513.complete Sequence

215 bp assembled on 2011-01-11

GenBank Submission: KX804702

> BS20513.complete
GAAGTTATCAGTCGACATGGTGAGGAAGCACAAAGGAACACTGGCGGTGA
TCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAG
GAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGT
GGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCTAAA
AGCTTTCTAGACCAT

BS20513.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-RD 183 CG33155-PD 1..183 17..199 915 100 Plus
CG33155-RC 183 CG33155-PC 1..183 17..199 915 100 Plus
CG33155-RA 183 CG33155-PA 1..183 17..199 915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-RD 942 CG33155-RD 695..877 17..199 915 100 Plus
CG33155-RC 829 CG33155-RC 582..764 17..199 915 100 Plus
CG33155-RA 725 CG33155-RA 478..660 17..199 915 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13955417..13955599 17..199 915 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:41:49 has no hits.

BS20513.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:32 Download gff for BS20513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RC 578..758 17..197 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:31 Download gff for BS20513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RA 478..658 17..197 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:23 Download gff for BS20513.complete
Subject Subject Range Query Range Percent Splice Strand
CG33155-RA 478..658 17..197 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:23 Download gff for BS20513.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13955417..13955597 17..197 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:31 Download gff for BS20513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9842922..9843102 17..197 100   Plus

BS20513.pep Sequence

Translation from 16 to 198

> BS20513.pep
MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS
RFITIKPVDF*

BS20513.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG33155-PD 60 CG33155-PD 1..60 1..60 308 100 Plus
CG33155-PC 60 CG33155-PC 1..60 1..60 308 100 Plus
CG33155-PA 60 CG33155-PA 1..60 1..60 308 100 Plus