BS20513.complete Sequence
215 bp assembled on 2011-01-11
GenBank Submission: KX804702
> BS20513.complete
GAAGTTATCAGTCGACATGGTGAGGAAGCACAAAGGAACACTGGCGGTGA
TCGAGAAGATCTACCAGGATATACCCGCATTCTCCGACATCTTCACCGAG
GAGAGCTTCTACATGTTCGCCTTCTGTTTCGTGTGCGCCACCATTCTGGT
GGCCTTCATTCTCTCCCGGTTCATCACCATCAAGCCCGTCGATTTCTAAA
AGCTTTCTAGACCAT
BS20513.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:41:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-RD | 183 | CG33155-PD | 1..183 | 17..199 | 915 | 100 | Plus |
CG33155-RC | 183 | CG33155-PC | 1..183 | 17..199 | 915 | 100 | Plus |
CG33155-RA | 183 | CG33155-PA | 1..183 | 17..199 | 915 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:41:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-RD | 942 | CG33155-RD | 695..877 | 17..199 | 915 | 100 | Plus |
CG33155-RC | 829 | CG33155-RC | 582..764 | 17..199 | 915 | 100 | Plus |
CG33155-RA | 725 | CG33155-RA | 478..660 | 17..199 | 915 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:41:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 13955417..13955599 | 17..199 | 915 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:41:49 has no hits.
BS20513.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-09 09:37:32 Download gff for
BS20513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RC | 578..758 | 17..197 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:56:31 Download gff for
BS20513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RA | 478..658 | 17..197 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:18:23 Download gff for
BS20513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33155-RA | 478..658 | 17..197 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:18:23 Download gff for
BS20513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 13955417..13955597 | 17..197 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:56:31 Download gff for
BS20513.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 9842922..9843102 | 17..197 | 100 | | Plus |
BS20513.pep Sequence
Translation from 16 to 198
> BS20513.pep
MVRKHKGTLAVIEKIYQDIPAFSDIFTEESFYMFAFCFVCATILVAFILS
RFITIKPVDF*
BS20513.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:08:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33155-PD | 60 | CG33155-PD | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PC | 60 | CG33155-PC | 1..60 | 1..60 | 308 | 100 | Plus |
CG33155-PA | 60 | CG33155-PA | 1..60 | 1..60 | 308 | 100 | Plus |